Темная лесная пчела  - Apis mellifera mellifera L. - Dark European Honeybees

Институт биохимии и генетики
Уфимского научного центра
Российской академии наук


Institute of biochemistry and genetics
of Ufa scientific center
of Russia academy of sciences

Лаборатория биохимии адаптивности насекомых

The Laboratory of biochemistry of insects adaptability

Заведующий лабораторией
доктор биологических наук, проф.

Николенко Алексей Геннадьевич

Head of the The Laboratory is
Doctor of Sciences, Prof.

Alexey G. NIKOLENKO



Старший научный сотрудник
доктор биологических наук

Ильясов Рустем Абузарович


Research Associate
Doctor of Sciences in Biology

Rustem A. ILYASOV

Cписок публикаций (
Статьи в PDF для скачивания)

List of publications (
Articles in PDF for Downloads)

Ильясов Р.А. Ilyasov R.A.


 Curriculum Vitae

Резюме



   
Гостевая книга Guest book
Контакты Contacts
Телефон / Факс +7 (347) 235-60-88 Phone / Fax +7 (347) 235-60-88
Адрес: 450054, Россия, Уфа, Проспект Октября, 71 Address: 450054,     Russia, Ufa,     Prospekt Oktyabrya, 71
Эл. почта1: apismell@hotmail.com
Эл. почта2: apismell@mail.ru
E-mail1: apismell@hotmail.com
E-mail2: apismell@mail.ru
Сайты - Sites:
eLibrary SPIN-code: 8302-8152
eLibrary AuthorID: 156929
http://elibrary.ru/author_items.asp?authorid=156929
http://www.researcherid.com/rid/O-2665-2014
https://www.scopus.com/authid/detail.uri?authorId=44461460200
https://www.mendeley.com/profiles/rustem-ilyasov2
http://orcid.org/0000-0003-2445-4739
https://www.researchgate.net/profile/Rustem_Ilyasov2
https://anrb.academia.edu/RustemIlyasov
https://mapofscience.ru/scientist/860322
https://scholar.google.com/citations?user=Bd4jC5IAAAAJ&hl=en
http://vk.com/id38600975
https://www.facebook.com/rustem.ilyasov.58
http://istina.msu.ru/profile/RusApis2017
http://biomics.ru
http://ibg.anrb.ru
http://amellifera.narod.ru
http://ilyasov.tripod.com

Сайт изменен 21 октября 2018 The site modified at October, 21, 2018
 №. Ilyasov R.A.,
Образец текста
 233. Ilyasov,R.A., Han,G.-Y., Lim,S.H., Kim,D.-I. and Kwon,H.W. The genetic structure of Apis cerana population in South Korea based on Vitellogenin gene polymorphism. GenBank. 2018. Accession numbers MH755714-MH755923 (http://www.ncbi.nlm.nih.gov).
LOCUS 01-VG-E2 586 bp DNA linear INV 16-AUG-2018 DEFINITION Apis cerana. ACCESSION MH755714 KEYWORDS . SOURCE Apis cerana (Asiatic honeybee) ORGANISM Apis cerana Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Holometabola; Hymenoptera; Apocrita; Aculeata; Apoidea; Apidae; Apis. REFERENCE 1 (bases 1 to 586) AUTHORS Ilyasov,R.A., Han,G.-Y., Lim,S.H., Kim,D.-I. and Kwon,H.W. TITLE The genetic structure of Apis cerana population in South Korea based on Vitellogenin gene polymorphism JOURNAL unpublished REFERENCE 2 (bases 1 to 586) AUTHORS Ilyasov,R.A., Han,G.-Y., Lim,S.H., Kim,D.-I. and Kwon,H.W. TITLE Direct Submission JOURNAL Submitted (16-AUG-2018) Division of Life Sciences, Incheon National University, 119 Academy-ro, Yeonsu-gu, Songdo-dong, Incheon 22012, South Korea COMMENT Bankit Comment: ALT EMAIL:apismell@mail.ru Bankit Comment: TOTAL # OF SEQS:35 ##Assembly-Data-START ##Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers CDS <1..>586 /gene="VG" /codon_start=1 /product="Vitellogenin" /translation="HSWKVGNEYTYLVRSRTLTSLGDLSDVHTGILIKALLTVQAKDS NVLDAKVWNGQYARIQQSMPDGWETEISDQMLELRDLPISGKPFQIRMKHGLIRDLIV DRDVPTWEVNLLKSIVAQLQVDTQGNNAIRMNSMQVPTDNDPYASFKAMEDSMGGKCE VLYDIAPLSDFVIHRSPELVPMPTLKGDGHHMEII" exon <1..>586 /gene="VG" /number=2 /label="Exon 2" gene <1..>586 /gene="VG" source 1..586 /organism="Apis cerana" /mol_type="genomic DNA" /specimen_voucher="Kwon H.W." /db_xref="taxon:7461" /ecotype="Icheon, Gyeonggido" /country="South Korea" /collection_date="2015" /collected_by="Kwon H.W." ORIGIN 1 CACAGTTGGA AAGTCGGGAA TGAGTACACG TATCTCGTTC GAAGTCGCAC ATTGACCAGT 61 TTGGGCGATC TGTCGGACGT GCATACCGGT ATTCTGATAA AGGCGTTGCT CACCGTACAG 121 GCGAAGGATT CGAACGTGCT TGATGCCAAA GTGTGGAATG GCCAGTATGC TCGTATCCAG 181 CAGTCCATGC CCGATGGATG GGAAACGGAG ATCTCCGACC AAATGTTGGA GCTTCGTGAC 241 CTGCCTATTT CCGGCAAACC GTTCCAAATC AGGATGAAAC ATGGCTTGAT CAGGGATCTG 301 ATCGTGGATC GCGACGTTCC CACCTGGGAG GTGAACCTAC TCAAGAGCAT CGTTGCCCAA 361 TTGCAAGTGG ACACTCAAGG TAACAACGCC ATCAGGATGA ACAGCATGCA AGTTCCGACC 421 GACAACGACC CGTACGCTTC GTTCAAAGCC ATGGAGGACT CCATGGGAGG GAAATGCGAG 481 GTTCTCTACG ATATAGCGCC TTTGTCGGAC TTCGTGATCC ACAGATCGCC GGAATTGGTG 541 CCGATGCCGA CGTTGAAGGG CGATGGGCAC CACATGGAGA TCATCA // LOCUS TT2_VgE7 421 bp DNA linear INV 16-AUG-2018 DEFINITION Trace of F:\RUSTEM\MATERIALS\SEQUENCE\2018\Vitellogenin\Sequencing results\Vitellogenin cerana\Exon7 Cerana\!Vg_E7 2018.05.30 foreign\ab1\TT2-E7_Vg_E7_F.ab1; length: 1032; low quality 685; medium quality 88; high quality 259. ACCESSION MH755923 KEYWORDS . SOURCE Apis cerana (Asiatic honeybee) ORGANISM Apis cerana Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Holometabola; Hymenoptera; Apocrita; Aculeata; Apoidea; Apidae; Apis. REFERENCE 1 (bases 1 to 421) AUTHORS Ilyasov,R.A., Han,G.-Y., Lim,S.H., Kim,D.-I. and Kwon,H.W. TITLE The genetic structure of Apis cerana population in South Korea based on Vitellogenin gene polymorphism JOURNAL unpublished REFERENCE 2 (bases 1 to 421) AUTHORS Ilyasov,R.A., Han,G.-Y., Lim,S.H., Kim,D.-I. and Kwon,H.W. TITLE Direct Submission JOURNAL Submitted (16-AUG-2018) Division of Life Sciences, Incheon National University, 119 Academy-ro, Yeonsu-gu, Songdo-dong, Incheon 22012, South Korea COMMENT Bankit Comment: ALT EMAIL:apismell@mail.ru Bankit Comment: TOTAL # OF SEQS:35 ##Assembly-Data-START ##Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers CDS <1..>421 /gene="VG" /codon_start=2 /product="Vitellogenin" /translation="NDFMGPKNCLFRKPEHFIASYALINNQCEGDSLNVAKSLQDHDC IRQEKTRQSNVISDSESGRSDTEMSTWGHQNVNKHCMIHRTQVKETDDKICFTMHPVV SCASGCTAVETKLKPYKFHCMEKNEAAMKLKKRIEKGA" exon <1..>421 /gene="VG" /number=7 /label="Exon 7" gene <1..>421 /gene="VG" source 1..421 /organism="Apis cerana" /mol_type="genomic DNA" /specimen_voucher="Kwon H.W." /db_xref="taxon:7461" /ecotype="Taichung" /country="Taiwan" /collection_date="2015" /collected_by="Kwon H.W." ORIGIN 1 CAACGACTTC ATGGGACCCA AGAACTGCCT ATTCAGAAAG CCAGAACACT TCATAGCCAG 61 CTACGCTTTG ATCAATAACC AGTGCGAGGG CGACTCGTTG AACGTGGCGA AATCTCTTCA 121 GGATCACGAT TGCATCCGAC AGGAGAAGAC CCGGCAGAGC AATGTGATCA GCGACAGCGA 181 ATCGGGACGA TCGGACACTG AGATGTCGAC TTGGGGCCAC CAAAATGTTA ACAAACATTG 241 CATGATTCAC AGAACCCAGG TAAAGGAGAC CGACGACAAG ATCTGCTTCA CCATGCATCC 301 AGTAGTCTCT TGCGCGTCTG GTTGCACGGC CGTCGAGACG AAATTGAAAC CGTACAAGTT 361 CCACTGCATG GAGAAGAACG AGGCCGCGAT GAAGCTGAAG AAGAGAATCG AGAAGGGCGC 421 C //
 232. Ilyasov R.A, Proshchalykin M.Yu., Leley A.S., Takahashi J., Kwon H.W. The Russian Far East Apis cerana is a distinct subspecies proved from the mitochondrial, nuclear, and morphological data. Materials of the 34th Conference of the Apicultural Society of Korea. Chilgok, Korea. 11-13.10.2018. P. 28. (Ильясов Р.А., Прощалыкин М.Ю., Лелей А.С., Такахаши Д., Квон Х.В. Дальневосточная Apis cerana отдельный подвид по митохондриальным, ядерным и морфологическим данным. Материалы 32-й конференции общества пчеловодов Кореи. Чхильгок, Корея. 11-13.10.2018. C. 28.)
Ilyasov R.A, Proshchalykin M.Yu., Leley A.S., Takahashi J., Kwon H.W. The Russian Far East Apis cerana is a distinct subspecies proved from the mitochondrial, nuclear, and morphological data. Materials of the 34th Conference of the Apicultural Society of Korea. Chilgok, Korea. 11-13.10.2018. P. 28. (Ильясов Р.А., Прощалыкин М.Ю., Лелей А.С., Такахаши Д., Квон Х.В. Дальневосточная Apis cerana отдельный подвид по митохондриальным, ядерным и морфологическим данным. Материалы 32-й конференции общества пчеловодов Кореи. Чхильгок, Корея. 11-13.10.2018. C. 28.) Apis cerana is the Eastern honeybee species distributed in the most Asian countnes with the tropical climate in the South and the temperate climate in the North. We sequenced and annotated the complete mitochondrial DNA (mtDNA) of A cerana from Vladivostok, Primorskii krai of the Russian Far East and uploaded to database Genbank (APO18450). MtDNA sequence has 15,919 bp length, AT-content 84% and GC-content 16% and contains 22 tRNA genes, 13 protein-coding genes, two nbosomal RNA genes, f one AT-rich region and four non-coding intergenic regions fNCl-4). All protein-coding genes are started by A IT and ATG codons, excepting the start codon of ATP8 gene, which ATC, and are stopped by the common stop codons TAA and TAG. A comparative analysis ot complete mtDNA of A. cerana from Russia. Korea, Taiwan. Malaysia, China, and Japan found that the Russian Far East Apis cerana differ from others on the subpopulation level. Based on comparative analysis of complete mtDNA ( -16,000 bp), nuclear gene lltellogenin (VG) (-4,100 bp) and morphological measurements (six parameters) we assumed that Russian Far-East A. cerana is a distinct northern subspecies, which can be named as a subspecies of Apis cerana ussuriensis.
 231. Ilyasov R.A., Park J.H., Takahashi J., Lim S.H., Han G.Y., Song J.H., Kwon H.W. Unique subspecies of Asian bees Apis cerana in Korean peninsula. Materials of the 33th Conference of the Apicultural Society of Korea. Gwangju, Korea. 13.04.2018. P. 26. (Ильясов Р.А., Парк Д.Х., Такахаши Д., Лим С.Х., Хан Г.Ю., Сонг Д.-Х., Квон Х.В. Уникальный подвид Apis cerana на Корейском Полуострове. Материалы 32-й конференции общества пчеловодов Кореи. Кванджу, Корея. 13.04.2018. C. 26.)
Ilyasov R.A., Park J.H., Takahashi J., Lim S.H., Han G.Y., Song J.H., Kwon H.W. Unique subspecies of Asian bees Apis cerana in Korean peninsula. Materials of the 33th Conference of the Apicultural Society of Korea. Gwangju, Korea. 13.04.2018. P. 26. (Ильясов Р.А., Парк Д.Х., Такахаши Д., Лим С.Х., Хан Г.Ю., Сонг Д.-Х., Квон Х.В. Уникальный подвид Apis cerana на Корейском Полуострове. Материалы 32-й конференции общества пчеловодов Кореи. Кванджу, Корея. 13.04.2018. C. 26.) Apis cerana is sisterly related to a honeybee species Apis mellifera, which is highly important in agriculture in most Asian countries. The size of A. cerana population is decreasing every year due to Korean Sacbrood Virus (KSBV) and other diseases. It is believed that A. cerana populations are subdivided into several numbers of subspecies adapted to different climates, similar to Apis mellifera. Full mitochondrial genome of A. cerana from different countries and populations have been studied insufficiently. To date, full mitochondrial DNA (mtDNA) sequence of A. cerana from Korean peninsula have not been researched. Here, we sequenced and annotated the full mitochondrial genome of A.cerana from Jeollanam-do province of South Korea, which is most densely populated area of A. cerana. The mtDNA sequence consisted of 15,925 bp length, A + T content 84% and C + G content 16% and contains 22 tRNA genes, 13 protein-coding genes, 2 ribosomal RNA genes, 1 AT-rich region, and 4 known non-coding intergenic loci (NC1-4). Comparative analysis of A. cerana full mtDNA sequences showed that Korean A. cerana was more similar with Japanese and Chinese samples than Taiwanese species. Japanese and Korean samples were subdivided in one common group located separately. Thus, based on analysis of full mtDNA sequences the samples of Korean A. cerana can be named as subspecies Apis cerana koreana.
 230. Lim S.H., Ilyasov R.A., Goto K., Noh G.R., Kim D.I., Takahashi J., Kwon H.W. Comparison of mitochondrial genome of two honeybee subspecies, A. mellifera caucasica and A. mellifera carpathica. Materials of the 33th Conference of the Apicultural Society of Korea. Gwangju, Korea. 13.04.2018. P. 40. (Лим С.Х., Ильясов Р.А, Гото К., Нох Г.Р., Ким Д.И., Такахаши Д., Квон Х.В. Сравнение митохондриальных геномов двух подвидов пчел A. mellifera caucasica и A. mellifera carpathica. Материалы 32-й конференции общества пчеловодов Кореи. Кванджу, Корея. 13.04.2018. C. 40.)
Lim S.H., Ilyasov R.A., Goto K., Noh G.R., Kim D.I., Takahashi J., Kwon H.W. Comparison of mitochondrial genome of two honeybee subspecies, A. mellifera caucasica and A. mellifera carpathica. Materials of the 33th Conference of the Apicultural Society of Korea. Gwangju, Korea. 13.04.2018. P. 40. (Лим С.Х., Ильясов Р.А, Гото К., Нох Г.Р., Ким Д.И., Такахаши Д., Квон Х.В. Сравнение митохондриальных геномов двух подвидов пчел A. mellifera caucasica и A. mellifera carpathica. Материалы 32-й конференции общества пчеловодов Кореи. Кванджу, Корея. 13.04.2018. C. 40.) The complete mitochondrial DNA (mtDNA) sequence of honeybee subspecies A. m. caucasica and A. m. carpathica has been analyzed for the first time. Our results showed that length of A. m. caucasica and A. m. carpathica mtDNA sequences are 16,341 bp and 16,336 bp, respectively. Both sequences contained 13 protein-coding genes, 22 transfer RNA genes, 2 ribosomal RNA genes, and 1 AT-rich region. The overall composition of nucleotides in mtDNA in A. m. caucasica / A. m. carpathica is A (43.2/43.3%), C (9.5/9.6%), G (5.6/5.5%), and T (41.6/41.6%). Most of coding genes (CDS) (ND2, COX1, COX2, ATP8, ATP6, COX3, ND3, ND6, CYTB), and 14 tRNA genes are located on the heavy strand for both sequences. Four CDS genes (ND1, ND4, ND4L, ND5), 2 rRNA genes (12S rRNA, 16S rRNA), and 8 tRNA genes are located on the light strand for both sequences. A comparative analysis of whole mtDNA sequences of A. m. caucasica and A. m. carpathica has showed that A. m. caucasica belonged to the O lineage, in contrast to A. m. carpathica belonging to the C lineage. We suggested 34 SNPs, which allowed to differentiate subspecies A. m. caucasica and A. m. carpathica. These complete mtDNA sequence of honeybee subspecies A. m. caucasica and A. m. carpathica can be useful for further phylogenetic and population genetic studies in honeybees.
 229. Ильясов Р.А., Николенко А.Г., Туктаров В.Р., Гото К., Такахаши Д., Квон Х.В. Митохондриальные геномы пчел подвидов A. m. caucasica и A. m. carpathica. Тезисы докладов XXII Международного Конгресса Апиславия-2018. Москва. 09-13 сентября 2018 г. С. 33-36. 164 с. ISBN 978-5-900205-67-0. (Ilyasov R.A., Nikolenko A.G., Tuktarov V.R., Goto K., Takahashi J.I., Kwon H.W. Mitochondrial genomes of the honeybee subspecies A. m. caucasica и A. m. carpathica. Abstracts of the XXII International Congress of Apislavia-2018. Moscow. 09-13 September 2018. P. 33-36. 164 pp. ISBN 978-5-900205-67-0.)
Ильясов Р.А., Николенко А.Г., Туктаров В.Р., Гото К., Такахаши Д., Квон Х.В. Митохондриальные геномы пчел подвидов A. m. caucasica и A. m. carpathica. Тезисы докладов XXII Международного Конгресса Апиславия-2018. Москва. 09-13 сентября 2018 г. С. 33-36. 164 с. ISBN 978-5-900205-67-0. (Ilyasov R.A., Nikolenko A.G., Tuktarov V.R., Goto K., Takahashi J.I., Kwon H.W. Mitochondrial genomes of the honeybee subspecies A. m. caucasica и A. m. carpathica. Abstracts of the XXII International Congress of Apislavia-2018. Moscow. 09-13 September 2018. P. 33-36. 164 pp. ISBN 978-5-900205-67-0.) Аннотация. Известно, что генофонд многих подвидов пчел, в том числе A. m. caucasica и A. m. carpathica находятся под угрозой исчезновения вследствие их гибридизации с другими подвидами пчел в пределах естественного ареала (Péntek-Zakar et al., 2015). До настоящего времени полные мтДНК A. m. caucasica и A. m. carpathica не были изучены. В данной работе нами были определены и загружены в Генбанк полные последовательности мтДНК A. m. caucasica (AP018404) and A. m. carpathica (AP018403). Рабочие особи пчел, ранее идентифицированные с использованием морфометрического анализа как подвиды A. m. caucasica и A. m. carpathica (Alpatov, 1948) были отобраны с пасек, расположенных в Сочинском районе Краснодарского края и Майкопском районе Республики Адыгея. Тотальную ДНК извлекали из торакса рабочих особей пчел, используя набор ДНК-ЭКСТРАН (СИНТОЛ, Россия). Нуклеотидные последовательности мтДНК A. m. caucasica и A. m. carpathica были определены в факультете естественных наук Киотского Университета Сангё (Япония) с использованием технологии секвенирования Illumina Next Seq 500 (ILLUMINA, США), используя стандартный протокол для анализа мтДНК медоносной пчелы. Выявленные нуклеотидные последовательности мтДНК были загружены в базы данных DDBJ/GenBank под номерами доступа AP018404 для A. m. caucasica и AP018403 для A. m. carpathica. Полные последовательности мтДНК пчел подвидов A. m. caucasica и A. m. carpathica составили 16341 п.н. и 16336 п.н., соответственно. Мы определили долю нуклеотидов A, C, G и T и наиболее важных пар GC и AT в мтДНК подвидов пчел. Среднее содержание GC и AT-нуклеотидов в мтДНК пчел подвидов A. m. caucasica и A. m. carpathica составляло 15,1% и 84,9%, соответственно. Сравнительный анализ выровненной полной мтДНК A. m. caucasica и A. m. carpathica показал 125 полиморфных сайтов, 30 из которых - инсерции, 40 - делеции, 37 - транзиции, 18 - трансверсии. Соотношение транзиций к трансверсиям в мтДНК составляет 2,05. Сравнительный анализ полной мтДНК A. m. caucasica и A. m. carpathica обнаружил 125 однонуклеотидных полиморфных сайтов (SNP) и показал 99,24% идентичности. МтДНК A. m. caucasica и A. m. carpathica обладали высоким сходством с референсной последовательностью A. m. ligustica (NC_001566) и содержали 13 белок-кодирующих генов, 22 гена тРНК, 2 гена рРНК и АТ-богатую регуляторную область. Некоторые гены мтДНК A. m. caucasica и A. m. carpathica, такие как гены ND2 и тРНК-Cys, ATP6 и ATP8, COX1 и тРНК-Leu, COX2 и тРНК-Asp, перекрываются между собой. Тяжелая цепь мтДНК пчел подвидов A. m. caucasica и A. m. carpathica содержит 9 белок-кодирующих генов, 14 генов тРНК, а легкая цепь мтДНК содержит 4 белок-кодирующих гена, 8 генов тРНК и 2 гена рРНК. Проанализированы полные последовательности митохондриального генома подвидов медоносных пчел A. m. caucasica и A. m. carpathica. Обе последовательности митохондриальной ДНК (мтДНК) содержали 13 белок-кодирующих генов (CDS), 22 гена транспортной РНК (тРНК), 2 гена рибосомальной РНК (рРНК) и одну АТ-богатую регуляторную область. Общий состав нуклеотидов в мтДНК A. m. caucasica / A. m. carpathica - A (43,2 / 43,3%), C (9,5 / 9,6%), G (5,6 / 5,5%) и T (41,6 / 41,6%). Abstract. It is known that the gene pool of many subspecies of bees, including A. m. caucasica and A. m. carpathica are endangered due to their hybridization with other bees subspecies within the natural range (Péntek-Zakar et al., 2015). Until now, complete mtDNA A. m. caucasica and A. m. carpathica have not been studied. In this paper, we sequenced and uploaded into Genbank complete sequences of mtDNA of A. m. caucasica (AP018404) and A. m. carpathica (AP018403). Worker bees, previously identified using morphometric analysis as subspecies A. m. caucasica and A. m. carpathica (Alpatov, 1948) were collected from apiaries located in the Sochi district of the Krasnodar Krai and the Maikop district of the Republic of Adygea. Total DNA was extracted from the thorax of worker bees using a set of DNA-EXTRAN (SINTOL, Russia). Nucleotide sequences of mtDNA A. m. caucasica and A. m. carpathica were identified in the Faculty of Natural Sciences of Kyoto University of Sangyo (Japan) using Illumina Next Seq 500 sequencing technology (ILLUMINA, USA) using a standard protocol for the analysis of mtDNA of the honeybee. The identified mtDNA nucleotide sequences were uploaded into the DDBJ/GenBank databases under accession numbers AP018404 for A. m. caucasica and AP018403 for A. m. carpathica. The complete sequences of mtDNA honeybee subspecies A. m. caucasica and A. m. carpathica is 16,341 bp. and 16,336 bp, respectively. We determined the contents of nucleotides A, C, G and T and the most important pairs GC and AT in the mtDNA of the bee subspecies. The average content of GC and AT-nucleotides in the mtDNA of honeybee subspecies A. m. caucasica and A. m. carpathica was 15.1% and 84.9%, respectively. Comparative analysis of the aligned full mtDNA A. m. caucasica and A. m. carpathica showed 125 polymorphic sites, 30 of which - insertions, 40 - deletions, 37 - transitions, 18 - transversions. The ratio of transitions to transversions in mtDNA is 2.05. Comparative analysis of total mtDNA A. m. caucasica and A. m. carpathica detected 125 single nucleotide polymorphic sites (SNP) and showed 99.24% identity. MtDNA of A. m. caucasica and A. m. carpathica had a high similarity with the reference sequence A. m. ligustica (NC_001566) and contained 13 protein-coding genes, 22 tRNA genes, 2 rRNA genes and an AT-rich regulatory region. Some mtDNA genes of A. m. caucasica and A. m. carpathica, such as ND2 and tRNA-Cys, ATP6 and ATP8, COX1 and tRNA-Leu, COX2 and tRNA-Asp, overlapped. The heavy chain of mtDNA of honeybee subspecies A. m. caucasica and A. m. carpathica contains 9 protein-coding genes, 14 tRNA genes, and the light chain of mtDNA contains 4 protein-coding genes, 8 tRNA genes, and 2 rRNA genes. The complete sequences of the mitochondrial genome of the honeybee subspecies A. m. caucasica and A. m. carpathica. Both mitochondrial DNA (mtDNA) sequences contained 13 protein-coding genes (CDS), 22 transfer RNA (tRNA) genes, 2 ribosomal RNA (rRNA) genes, and one AT-rich regulatory region. A total composition of nucleotides in mtDNA of A. m. caucasica / A. m. carpathica - A (43.2 / 43.3%), C (9.5 / 9.6%), G (5.6 / 5.5%) and T (41.6 / 41.6%).
 228. Ильясов Р.А., Николенко А.Г., Туктаров В.Р., Гото К., Такахаши Д., Квон Х.В. Митохондриальные геномы кавказской A. m. caucasica и карпатской A. m. carpathica пчел. Известия Уфимского Научного Центра РАН. 2018. № 3(4). С. 35–43. DOI: 10.31040/2222-8349-2018-4-3-35-43. (Ilyasov R.A, Nikolenko A.G., Tuktarov V.R., Goto K., Takahashi J., Kwon H. W. Mitochondrial genomes of Caucasian A. m. caucasica and Carpathian A. m. carpathica honeybees. Proceedings of the RAS Ufa Scientific Centre. 3(4). 2018. P. 35-43. DOI: 10.31040/2222-8349-2018-4-3-35-43.)
Ильясов Р.А., Николенко А.Г., Туктаров В.Р., Гото К., Такахаши Д., Квон Х.В. Митохондриальные геномы кавказской A. m. caucasica и карпатской A. m. carpathica пчел. Известия Уфимского Научного Центра РАН. 2018. № 3(4). С. 35–43. DOI: 10.31040/2222-8349-2018-4-3-35-43. (Ilyasov R.A, Nikolenko A.G., Tuktarov V.R., Goto K., Takahashi J., Kwon H. W. Mitochondrial genomes of Caucasian A. m. caucasica and Carpathian A. m. carpathica honeybees. Proceedings of the RAS Ufa Scientific Centre. 3(4). 2018. P. 35-43. DOI: 10.31040/2222-8349-2018-4-3-35-43.) Аннотация. Проанализированы полные последовательности митохондриального генома подвидов медоносных пчел A. m. caucasica (16341 п.н.) и A. m. carpathica (16336 п.н.). Обе последовательности митохондриальной ДНК (мтДНК) содержали 13 белок-кодирующих генов (CDS), 22 генов транспортной РНК (тРНК), 2 гена рибосомальной РНК (рРНК) и одну АТ-богатую регуляторную область. Общий состав нуклеотидов в мтДНК A. m. caucasica / A. m. carpathica - A (43,2 / 43,3%), C (9,5 / 9,6%), G (5,6 / 5,5%) и T (41,6 / 41,6%). Показано, что 9 белок-кодирующих генов и 14 генов тРНК расположены на тяжелой цепи, а 4 белок-коди- рующих гена, 2 гена рРНК и 8 генов тРНК расположены на светлой нити для обоих подвидов. Результаты этого исследования могут быть полезны для дальнейших филогенетических и популяционных генетических исследований у пчел. Abstract. The complete mitochondrial genome sequence of honeybee subspecies A. m. caucasica (16341 bp) and A. m. carpathica (16336 bp) has been analyzed for the first time. Both mitochondrial genome sequences contained 13 protein-coding genes, 22 transfer RNA genes, 2 ribosomal RNA genes, and 1 AT-rich region. The overall composition of nucleotides in mitochondrial DNA (mtDNA) in A. m. caucasica / A. m. carpathica is - A (43,2 / 43,3%), C (9,5 / 9,6%), G (5,6 / 5,5%), and T (41,6 / 41,6%). The 9 CDS, and 14 тРЖ genes are located on the heavy strand for both sequences. Four CDS, 2 rRNA genes, and 8 тРHK genes are located on the light strand for both sequences. Results of this research can be useful for further phylogenetic and population genetic studies in honeybees.
 227. Каскинова М.Д., Гатауллин А.Р., Хасанов М.В., Ильясов Р.А., Квон Хюн Вук, Николенко А.Г. Оценка чистопородности популяции Apis mellifera mellifera L. на территории заказника Алтын-Солок. Известия Уфимского Научного Центра РАН. 2018. № 3(4). С. 51-56. DOI: 10.31040/2222-8349-2018-4-3-51-56. (Kaskinova M.D., Gataullin A.R., Khasanov M.V., Ilyasov R.A., Kwon Hyung Wook, Nikolenko A.G. The purebredness estimation of Apis mellifera mellifera L. population in the Altyn-Solok conservancy area. Proceedings of the RAS Ufa Scientific Centre. 3(4). 2018. P. 51-56. DOI: 10.31040/2222-8349-2018-4-3-51-56.)
Каскинова М.Д., Гатауллин А.Р., Хасанов М.В., Ильясов Р.А., Квон Хюн Вук, Николенко А.Г. Оценка чистопородности популяции Apis mellifera mellifera L. на территории заказника Алтын-Солок. Известия Уфимского Научного Центра РАН. 2018. № 3(4). С. 51-56. DOI: 10.31040/2222-8349-2018-4-3-51-56. (Kaskinova M.D., Gataullin A.R., Khasanov M.V., Ilyasov R.A., Kwon Hyung Wook, Nikolenko A.G. The purebredness estimation of Apis mellifera mellifera L. population in the Altyn-Solok conservancy area. Proceedings of the RAS Ufa Scientific Centre. 3(4). 2018. P. 51-56. DOI: 10.31040/2222-8349-2018-4-3-51-56.) Аннотация. Охрана генофонда темной лесной пчелы (Apis mellifera mellifera) на Южном Урале возложена на федеральный заповедник Шульган-таш и заказник РБ Алтын-Солок. Эти ООПТ находятся на территории Бурзянского района, характеризуются горным рельефом и обширными лесными массивами. Мониторинг генетической сохранности бурзянской популяции медоносной пчелы при помощи ДНК-маркеров ведётся нами с 1999 года. Ранее оценку подвидовой принадлежности медоносных пчел из заказника Алтын-Солок проводили в трех населенных пунктах, и для всех семей была подтверждена принадлежность к подвиду A.m.mellifera. Высокий уровень смертности бортевых семей в зимовку 2016-2017 потребовал проведение дополнительного анализа. Цель данной работы – анализ подвидовой принадлежности пчел из заказника Алтын-Солок при помощи девяти SSR маркеров. В исследовании были использованы рабочие пчелы из 45 бортевых семей, расположенных в 20 кварталах заказника Алтын-Солок. В качестве сравнительных групп были использованы выборки A.m.mellifera из Бурзянского района РБ (N = 389), собранные в период с 1999 по 2015 гг., и пчелы из Республики Адыгея (A.m.carnica, N=15), Краснодарского края (A.m.caucasica, A.m.carpatica, N=42) и Закарпатской области Украины (A.m.carpatica, N=15). В четверти исследуемых семей был выявлен аллель Q локуса COI-COII мтДHK, т.е. зафиксирован залёт роёв либо искусственная подсадка в борти семей южных подвидов. Интрогрессия на уровне ядерной ДНК варьиро- вала от 0.019 до 0.342 (при допустимой интрогрессии 0.100). Лишь в 11 из 20 кварталов доля генофонда эволюционной ветви М превышала требуемый уровень чистопородности 0.900. Для сохранения гено- фонда темной лесной пчелы на территории заказника рекомендуется исключить из дальнейшего разведе- ния гибридные семьи. Семьи из кварталов №33, 40, 14, 53, 39, 52 и 81 представляют собой ценный пле- менной материал для дальнейшей селекционной работы. Abstract. In the southern Urals, the official protection of the gene pool of the dark forest bee (Apis mellifera mellifera) is entrusted to the Shulgan-Tash federal conservancy area and the Altyn-Solok regional conservancy area, which are part of the integrated biosphere reserve of the Bashkir Urals. These protected areas are located on the territory of the Burzyan district, characterized by mountainous terrain and extensive forest areas. Genetic monitoring of the Burzyan population of honey bees with the help of DNA markers has been conducted by our laboratory since 1999. Since then, this population has been monitored for purebreeding. Earlier, an assessment of the honeybee subspecies from the Altyn-Solok was conducted in three localities. It was confirmed that these colonies belong to the A.m.mellifera. The high mortality rate of bee colonies in the winter of 2016-2017 required additional analysis. The aim of this study is to analyze the purebredness of A.m.mellifera population in the Altyn-Solok with the help of nine SSR markers. In this study we used worker bees from 45 colonies. As outgroups were used A.m.mellifera samples from the Burzyan district of the Republic of Bashkortostan (N =389), collected from 1999 to 2015, and bees from the Republic of Adygea (A.m.carnica, N=15), Krasnodar Krai (A.m.caucasica, A.m.carpatica, N=42) and the Zakarpattia Oblast of Ukraine (A.m.carpatica, N=15). In a quarter of the studied colonies, the allele Q of the locus COI-COII mtDNA was identified, i.e. recorded a swarm or importation of southern honeybee subspecies. The introgression at the level of nuclear DNA ranged from 0.019 to 0.342 (with an allowable introgression of 0.100). Only in 11 out of 20 quarters the share of the gene pool of the evolutionary branch M exceeded the required level of purebredness 0.900. To conserve the gene pool of a dark forest bee, it is recommended to exclude hybrid colonies from further breeding. Colonies from quarters № 33, 40, 14, 53, 39, 52 and 81 are valuable breeding material for further breeding work.
 226. Ильясов Р. А., Хан Г. Ю., Сонг Д. Х., Лим С. Х., Гайфуллина Л. Р., Салтыкова Е. С., Николенко А. Г., Квон Х. В. Нейропептиды медоносной пчелы. Часть 2. Пчеловодство. 2018. № 7. C. 24-26. (Ilyasov R. A., Han G. Y., Song J. H., Lim S. H., Gaifullina L. R. Saltykova E. S., Nikolenko A. G., Kwon H. W. Neuropeptides of honeybees. Part 2 (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2018. No.7. P. 24-26.)
Ильясов Р. А., Хан Г. Ю., Сонг Д. Х., Лим С. Х., Гайфуллина Л. Р., Салтыкова Е. С., Николенко А. Г., Квон Х. В. Нейропептиды медоносной пчелы. Часть 2. Пчеловодство. 2018. № 7. C. 24-26. (Ilyasov R. A., Han G. Y., Song J. H., Lim S. H., Gaifullina L. R. Saltykova E. S., Nikolenko A. G., Kwon H. W. Neuropeptides of honeybees. Part 2 (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2018. No.7. P. 24-26.) Аннотация. Нейропептиды насекомых участвуют в регуляции поведения, размножения, развития, роста и метаболизма. Нейропептиды играют жизненно важную функцию в пчелиной семье, обеспечивая социальное поведение и кастовую дифференциацию особей. В статье рассмотрены современные данные о классификации, строении, функциях и распространении нейропептидов у пчел и других насекомых. Также описаны особенности биосинтеза, процессинга и экспрессии нейропептидов насекомых. Показано, что нейропептиды могут быть успешно использованы для лечения пчел, для борьбы с насекомыми - вредителями и переносчиками болезней пчел. Вся доступная современная информация о нейропептидах пчел и других насекомых и их GPCR-рецепторах депонирована в специализированную базу данных нейропептидов насекомых DINeR. Abstract. Neuropeptides of insects involved in the regulation o f the behavior, reproduction, development, growth and metabolism. Neuropeptides play a vital role in the life of a honeybee colonies, providing social behavior and caste differentiation of individuals.In this paper, current data on the classification, structure, functions, and distribution of neuropeptides in insects have reviewed. Also, the article describes the features of biosynthesis, processing and expression o f honeybee and other insect neuropeptides. We have shown that neuropeptides can be used successfully to the treatment of bees and aslo to control pest-insects of honeybees and parasitic arachnids - bee disease vectors. All available up-to-date information o f honeybee and other insect neuropeptides and their GPCR receptors deposited into the specialized database o f insect neuropeptides DINeR (Database for Insect Neuropeptide Research).
 225. Ильясов Р. А., Хан Г. Ю., Сонг Д. Х., Лим С. Х., Гайфуллина Л. Р., Салтыкова Е. С., Николенко А. Г., Квон Х. В. Нейропептиды медоносной пчелы. Часть 1. Пчеловодство. 2018. № 6. C. 16-19. (Ilyasov R. A., Han G. Y., Song J. H., Lim S. H., Gaifullina L. R. Saltykova E. S., Nikolenko A. G., Kwon H. W. Neuropeptides of honeybees. Part 1 (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2018. No.6. P. 16-19.)
Ильясов Р. А., Хан Г. Ю., Сонг Д. Х., Лим С. Х., Гайфуллина Л. Р., Салтыкова Е. С., Николенко А. Г., Квон Х. В. Нейропептиды медоносной пчелы. Часть 1. Пчеловодство. 2018. № 6. C. 16-19. (Ilyasov R. A., Han G. Y., Song J. H., Lim S. H., Gaifullina L. R. Saltykova E. S., Nikolenko A. G., Kwon H. W. Neuropeptides of honeybees. Part 1 (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2018. No.6. P. 16-19.) Аннотация. Нейропептиды насекомых участвуют в регуляции поведения, размножения, развития, роста и метаболизма. Нейропептиды играют жизненно важную функцию в пчелиной семье, обеспечивая социальное поведение и кастовую дифференциацию особей. В статье рассмотрены современные данные о классификации, строении, функциях и распространении нейропептидов у пчел и других насекомых. Также описаны особенности биосинтеза, процессинга и экспрессии нейропептидов насекомых. Показано, что нейропептиды могут быть успешно использованы для лечения пчел, для борьбы с насекомыми - вредителями и переносчиками болезней пчел. Вся доступная современная информация о нейропептидах пчел и других насекомых и их GPCR-рецепторах депонирована в специализированную базу данных нейропептидов насекомых DINeR. Abstract. Neuropeptides of insects involved in the regulation o f the behavior, reproduction, development, growth and metabolism. Neuropeptides play a vital role in the life of a honeybee colonies, providing social behavior and caste differentiation of individuals.In this paper, current data on the classification, structure, functions, and distribution of neuropeptides in insects have reviewed. Also, the article describes the features of biosynthesis, processing and expression o f honeybee and other insect neuropeptides. We have shown that neuropeptides can be used successfully to the treatment of bees and aslo to control pest-insects of honeybees and parasitic arachnids - bee disease vectors. All available up-to-date information o f honeybee and other insect neuropeptides and their GPCR receptors deposited into the specialized database o f insect neuropeptides DINeR (Database for Insect Neuropeptide Research).
 224. Гатауллин А. Р., Каскинова М. Д. , Ильясов Р. А. Генетическая структура популяции медоносной пчелы Нуримановского района республики Башкортостан. Вестник БГАУ. № 1. 2018. С. 48-52. (Gataullin A. , Kaskinova M., Ilyasov R. Genetic structure of the honeybee population in the Nurimanovo district of the Bashkorostan republic. Vestnik BSAU. № 1. 2018. P. 48-52.)
Гатауллин А. Р., Каскинова М. Д. , Ильясов Р. А. Генетическая структура популяции медоносной пчелы Нуримановского района республики Башкортостан. Вестник БГАУ. № 1. 2018. С. 48-52. (Gataullin A. , Kaskinova M., Ilyasov R. Genetic structure of the honeybee population in the Nurimanovo district of the Bashkorostan republic. Vestnik BSAU. № 1. 2018. P. 48-52.) Аннотация Генетическая структура популяций медо-носной пчелы в Республике Башкортостан изучена достаточно хорошо – обнаружены чистопо-родные и гибридные популяции темной лесной пчелы. Тем не менее, популяции некоторых районов Республики Башкортостан остались не изученными. Северные районы республики с обширными лесными массивами являются наиболее вероятными местами обитания сохранившейся популяции темной лесной пчелы A.m. mellifera L. В данной работе представлены результаты анализа генетической структуры по-пуляции медоносной пчелы из Нуримановского района РБ, одного из предполагаемых мест сохранения темной лесной пчелы. Оценка генофонда темной лесной пчелы по материнской линии была основана на анализе полиморфизма локуса мтДНК COI-COII и показала гибридное происхождение семей. Генетический анализ структуры выборки с помощью девяти микросателлитных маркеров выявил высокий уровень аутбридинга и дефицита гетерозигот. Результаты исследования позволяют предположить наличие массового завоза семей пчел из южных регионов России подвидов A.m. caucasica и A.m. carpatica в Нуримановский район Республики Башкортостан. Abstract The genetic structure of honeybee populations in the Republic of Bashkortostan has been studied quite well. There are purebred and hybrid popula-tions of a dark forest bee. Nevertheless, bee popula-tions in some areas of the Republic of Bashkortostan have not been studied. The northern regions of the republic with extensive forest areas are the most likely habitats of the preserved population of the dark forest bee A.m. mellifera L. This paper presents the results of an analysis of the genetic structure of a honey bee population in the Nurimanovo district of the Bashkortostan Republic, one of the areas where a dark forest bee could survive. Evaluation of the dark forest bee gene pool on the maternal line based on the analysis of the mtDNA COI-COII locus polymorphism showed the hybrid origin of families. A Genetic analysis of the sample structure using nine microsatellite markers revealed a high level of outbreeding and heterozygote deficiency. The results of the study suggest that there is a massive importation of bee colonies of subspecies A.m. caucasica and A.m. carpatica from the southern regions of Russia to the Nurimanovo district of the Republic of Bashkortostan.
 223. Ильясов Р.А., Хан Г.Ю., Сонг Д.Х., Лим С.Х., Квон Х.В. Особенности биосинтеза нейропептидов насекомых. Экобиотех, 2018, Т. 1, № 1, С. 52-62. DOI: 10.31163/2618-964X-2018-1-1-52-61. (Ilyasov R.A., Han G.Y., Song J.H., Lim S.H., Kwon H.W. Features of the insects neuropeptides biosynthesis. Ecobiotech, 2018, V. 1, No. 1, P. 52-62. DOI: 10.31163/2618-964X-2018-1-1-52-61.)
Ильясов Р.А., Хан Г.Ю., Сонг Д.Х., Лим С.Х., Квон Х.В. Особенности биосинтеза нейропептидов насекомых. Экобиотех, 2018, Т. 1, № 1, С. 52-62. DOI: 10.31163/2618-964X-2018-1-1-52-61. (Ilyasov R.A., Han G.Y., Song J.H., Lim S.H., Kwon H.W. Features of the insects neuropeptides biosynthesis. Ecobiotech, 2018, V. 1, No. 1, P. 52-62. DOI: 10.31163/2618-964X-2018-1-1-52-61.) Аннотация В статье рассмотрены современные данные о классификации, строении, функциях и распространении нейропептидов у насекомых. Также в статье описываются особенности биосинтеза, процессинга и экспрессии нейропептидов насекомых. Вся доступная современная информация о нейропептидах насекомых и их GPCR (G protein– coupled receptors) рецепторах депонирована в специализированную базу данных нейропептидов насекомых DINeR (Database for Insect Neuropeptide Research). Возможно, что достижения в исследованиях нейропептидов могут быть использованы для создания высокоактивных и экологически безопасных лекарств для полезных насекомых и средств борьбы с насекомыми- вредителями и переносчиками болезней. Abstract In this paper, current data on the classification, structure, functions, and distribution of neuropeptides in insects have reviewed. Also, the article describes the features of biosynthesis, processing and expression of insect neuropeptides. All available up-to-date information on insect neuropeptides and their G protein–coupled receptors (GPCR) deposited into the specialized database of insect neuropeptides DINeR (Database for Insect Neuropeptide Research). Perhaps the advances in of neuropeptide researches can be used to create highly active and ecologically safe drugs for beneficial insects and means of struggle against pest and disease vectors.
 222. Джунг Д. В., Ким Д. И., Ильясов Р. А., Ким К. В., Квон Х. В. Особенности памяти у пчел Apis cerana и Apis mellifera. Пчеловодство. 2018. № 4. С. 20-23. (Jung J. W., Kim D. I., Ilyasov R. A., Kim K. W., Kwon H. W. Features of memory in two bee species Apis cerana and Apis mellifera (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2018. No. 4. P. 20-23.)
Джунг Д. В., Ким Д. И., Ильясов Р. А., Ким К. В., Квон Х. В. Особенности памяти у пчел Apis cerana и Apis mellifera. Пчеловодство. 2018. № 4. С. 20-23. (Jung J. W., Kim D. I., Ilyasov R. A., Kim K. W., Kwon H. W. Features of memory in two bee species Apis cerana and Apis mellifera (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2018. No. 4. P. 20-23.) Apis сеrana и Apis mellifera — родственные виды пчел, которые дивергировали несколько миллионов лет назад и были длительное время географически изолированы. Несколько сотен лет назад эти виды снова встретились в Азии в результате антропогенной деятельности. Оба вида — важные опылители и играют ключевую роль в жизни человека. Для успешного развития пчелам важно быстро формировать и сохранять разные условные рефлексы. Рабочие пчелы должны помнить путь как к цветущим растениям, так и обратно к ульям. Кроме того, рабочие пчелы должны запоминать запахи многих присутствующих цветов для хорошего ориентирования в пространстве и быстрого сбора нектара и пыльцы. Чтобы понять различия в особенностях запоминания и эффективности памяти у двух видов пчел, мы исследовали различия в формировании обонятельных навыков у A. mellifera и A. cerana на основе рефлекса удлинения хоботка на определенные запахи. Мы установили, что характер запоминания и эффективность памяти различны у этих видов пчел. Несмотря на большое сходство A. cerana и A. mellifera, формирование условного рефлекса у них происходит по-разному. Обучение A. cerana идет медленнее, чем A. mellifera, но кратковременная память через 1 ч у A. cerana выражена лучше, чем у A. mellifera. Однако долговременная память через 24 ч гораздо лучше выражена у A. mellifera. Полученные данные позволяют расширить знания о памяти и способностях к обучению у видов пчел и могут стать важной основой для разработки новых подходов по разведению пчел и опылению сельскохозяйственных культур. Apis cerana and Apis mellifera sisterly bee species, which diverged some million years ago and were long time geographically isolated. Last hundreds year ago these species met again in Asia due human actions. Both species are important pollinators and play key role in human life. For successful development of bees, it is important to quickly form and maintain various conditioned reflexes. Worker bees must remember the way to both flowering plants, and back to the hives. As well, worker bees must remember the smells o f most presented flowers for good orientation in space and quickly collecting nectar and pollen. In order to understand the differences in the memory and memory efficiency of the two species o f bees, we investigated the differences in the formation o f the olfactory skills of A. mellifera and A. cerana on the basis of the reflex of the elongation o f the proboscis on certain odors. Our present study demonstrated that learning and memory performance was different between two honeybee species. We showed the species of A. cerana and A. mellifera, despite their great similarity, have different abilities for forming a conditioned reflex of elongation of the proboscis under the influence of a conditional smell on the olfactory receptors of the antennae. Learning of A. cerana is slower than A. mellifera, but shortterm memory after 1 hour in A. cerana is expressed better than A. mellifera. However, the long-term memory after 24 hours is much better expressed in A. mellifera compared to A. cerana. The received data allow to expand a knowledges about abilities to training and memory of different species of bees and can become an important basis for the development of new approaches for breeding bees and pollination of crops.
 221. Джунг Д., Ким Д. И., Ильясов Р. A., Ким К., Квон Х. В. Особенности формирования условных рефлексов у двух видов пчел Apis cerana и Apis mellifera. Биомика, 2017. Т. 9. № 4. C. 364-369. (Jung J., Kim D. I., Ilyasov R. A., Kim K., Kwon H. W. Features of formation conditional reflexes in two bee species Apis cerana and Apis mellifera (translation). Biomics, 2017. V. 9(4). P. 364-369.)
Джунг Д., Ким Д. И., Ильясов Р. A., Ким К., Квон Х. В. Особенности формирования условных рефлексов у двух видов пчел Apis cerana и Apis mellifera. Биомика, 2017. Т. 9. № 4. C. 364-369. (Jung J., Kim D. I., Ilyasov R. A., Kim K., Kwon H. W. Features of formation conditional reflexes in two bee species Apis cerana and Apis mellifera (translation). Biomics, 2017. V. 9(4). P. 364-369.) Apis cerana и Apis mellifera, родственные виды пчел, которые дивергировали около 6 - 9 миллионов лет назад и были географически изолированы более миллиона лет. В последние несколько сотен лет назад эти виды снова встретились в Азии в результате антропогенной деятельности. Оба вида являются важными опылителями и играют ключевую роль в жизни человека. Для успешного развития пчелам важно быстро формировать и сохранять разные условные рефлексы. Рабочие пчелы должны помнить путь как к цветущим растениям, так и обратно к ульям. Кроме того, рабочие пчелы должны запоминать запахи многих присутствующих цветов для хорошего ориентирования в пространстве и быстрого сбора нектара и пыльцы. Чтобы понять различия в особенностях запоминания и эффективности памяти у двух видов пчел, мы исследовали различия в формировании обонятельных навыков A. mellifera и A. cerana на основе рефлекса удлинения хоботка на определенные запахи. Нами показано, что особенности запоминания и эффективность памяти различны у двух видов пчел. Мы показали, что виды пчел A. cerana и A. mellifera, несмотря на большое сходство, обладают разными способностями формирования условного рефлекса удлинения хоботка при воздействии условного запаха на обонятельные рецепторы антенн. Обучение A. cerana происходит медленнее A. mellifera, но кратковременная память через 1 час у A. cerana выражена лучше, чем у A. mellifera. Однако долговременная память через 24 часа гораздо лучше выражена у A. mellifera по сравнению с A. cerana. Полученные данные позволяют расширить знания о способностях к обучению и памяти у разных видов пчел и могут стать важной основой для разработки новых подходов по разведению пчел и опылению сельскохозяйственных культур. Apis cerana and Apis mellifera sisterly bee species, which diverged about 6 - 9 million years ago and were geographically isolated more than millions years. Last hundreds year ago these species met again in Asia due human actions. Both species are important pollinators and play key role in human life. For successful development of bees, it is important to quickly form and maintain various conditioned reflexes. Worker bees must remember the way to both flowering plants, and back to the hives. As well, worker bees must remember the smells of most presented flowers for good orientation in space and quickly collecting nectar and pollen. In order to understand the differences in the memory and memory efficiency of the two species of bees, we investigated the differences in the formation of the olfactory skills of A. mellifera and A. cerana on the basis of the reflex of the elongation of the proboscis on certain odors. Our present study demonstrated that learning and memory performance was different between two honeybee species. We showed the species of A. cerana and A. mellifera, despite their great similarity, have different abilities for forming a conditioned reflex of elongation of the proboscis under the influence of a conditional smell on the olfactory receptors of the antennae. Learning of A. cerana is slower than A. mellifera, but short-term memory after 1 hour in A. cerana is expressed better than A. mellifera. However, the long-term memory after 24 hours is much better expressed in A. mellifera compared to A. cerana. The received data allow to expand a knowledges about abilities to training and memory of different species of bees and can become an important basis for the development of new approaches for breeding bees and pollination of crops.
 220. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Современные методы оценки таксономической принадлежности семей пчел. Экологическая генетика. 2017. Т. 15. № 4. С. 41–51. DOI: 10.17816/ecogen15441-51. (Ilyasov RA, Poskryakov AV, Nikolenko AG. Modern methods of assessing the taxonomic affiliation of honeybee colonies (translation). Ecological genetics. 2017. V. 15(4). P. 41-51. DOI: 10.17816/ecogen15441-51).
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Современные методы оценки таксономической принадлежности семей пчел. Экологическая генетика. 2017. Т. 15. № 4. С. 41–51. DOI: 10.17816/ecogen15441-51. (Ilyasov RA, Poskryakov AV, Nikolenko AG. Modern methods of assessing the taxonomic affiliation of honeybee colonies (translation). Ecological genetics. 2017. V. 15(4). P. 41-51. DOI: 10.17816/ecogen15441-51). В ходе эволюции аллопатрически формировалось 30 подвидов медоносной пчелы Apis mellifera L., которые распространены по всей территории Африки, Европы и Западной Азии. Темная лесная пчела Apis mellifera mellifera — единственный и наиболее ценный подвид для стран Северной и Западной Европы, приспособленный к продуктивной жизнедеятельности в резко континен- тальном климате Евразии. В последние 100 лет естественная географическая изоляция подвидов была нарушена в результате деятельности человека. Массовые перемещения семей пчел за пределы границ их ареалов создали угрозу потери чистопородно- сти аборигенных генофондов подвидов в результате гибридизации. Сохранение генофонда подвидов возможно лишь при контроле транспортировок семей пчел с использованием методов идентификации таксономической принадлежности. На данный момент разработаны десятки методов идентификации таксономической принадлежности семей пчел, которые основываются на вариа- бельности частей тела, аллозимных локусов, митохондриальной ДНК, микросателлитных локусов ядерной ДНК, сайтов однонук- леотидных замен (SNP). Вариабельность микросателлитных локусов и полиморфизм сайтов однонуклеотидных замен показали наибольшую информативность при идентификации таксономической принадлежности семей пчел. At least 30 subspecies of the honeybee Apis mellifera L. were formed allopatrically during the evolution, which spreaded throughout all Africa, Europe and West Asia. The dark forest bee Apis mellifera mellifera is the only and most valuable subspecies for the Northern and Western Europe countries, adapted to productive living in the hard-continental climate of Eurasia. In the past 100 years, natural geographical isolation of subspecies has been disrupted as a result of a human activities. Mass transportations of honeybee colonies beyond the boundaries of their area have been threatened of loss the identity of gene pool of subspecies as a result of hybridization. Preservation of the gene pool of subspecies is possible only when controlling the transportation of honeybee colonies using the methods of identification of taxonomic affiliation of honeybee colonies. Now, dozens of methods have been developed to identify the taxonomic affiliation of honeybee's colony, which are based on the variability of body parts, allozyme loci, mitochondrial DNA loci, microsatellite nuclear loci, sites of single nucleotide polymorphism (SNP). The variability of microsatellite loci and the single nucleotide polymorphism sites have shown the greatest informativeness in identification of the taxonomic affiliation of honeybee's colony.
 219. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Три сценария эволюции подвидов медоносной пчелы Apis mellifera. Часть 2. Пчеловодство. 2018. № 2. С. 28-30. (Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Three scenario of evolution of honeybee Apis mellifera subspecies. Part 2 (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2018. No.2. P. 28-30.)
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Три сценария эволюции подвидов медоносной пчелы Apis mellifera. Часть 2. Пчеловодство. 2018. № 2. С. 28-30. (Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Three scenario of evolution of honeybee Apis mellifera subspecies. Part 2 (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2018. No.2. P. 28-30.) АННОТАЦИЯ. Виды пчел A. cerana и A. mellifera географически были разобщены более миллиона назад и до активного вмешательства человека в последние сотни лет не контактировали друг с другом. Независимо друг от друга A. cerana и A. mellifera подразделились на десятки подвидов, адаптированных к широкому спектру климатических условий от 30° ю. ш. до 47° с. ш. Старого Света. Вероятно, широкое разнообразие природно-климатических условий привело к формированию 30 подвидов. Значительный прогресс в микроэволюции медоносной пчелы A. mellifera был достигнут в плейстоценовый ледниковый период, когда популяции пчел были изолированы в многочисленных рефугиях в течение 100 тыс. лет. В статье рассмотрены гипотезы широкой экспансии вида и формирования подвидов медоносной пчелы на основе данных полиморфизма ядерной и митохондриальной ДНК. --- ANNOTATION. The bee species A. cerana and A. mellifera geographically diverged more than millions years ago, and they did not contact each other before active human transporting in the last hundreds of years. Regardless of each other, A. cerana and A. mellifera subdivided into dozens of subspecies, which adapted to a wide range of climatic conditions from 30° of the south latitude to 47° of the north latitude of the Old World. Probably, a wide diversity of natural and climatic conditions led to the origin of 30 subspecies. Significant progress in the microevolution of the honeybee A. mellifera was achieved in the Pleistocene glacial period, when populations of bees were isolated in numerous refugia within 100 thousand years. In the article considered the hypotheses of wide expansion of species and of origin of honeybee subspecies based on polymorphism of nuclear and mitochondrial DNA.
 218. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Три сценария эволюции подвидов медоносной пчелы Apis mellifera. Часть 1. Пчеловодство. 2018. № 1. С. 20-22. (Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Three scenario of evolution of honeybee Apis mellifera subspecies. Part 1 (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2018. No.1. P. 20-22.)
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Три сценария эволюции подвидов медоносной пчелы Apis mellifera. Часть 1. Пчеловодство. 2018. № 1. С. 20-22. (Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Three scenario of evolution of honeybee Apis mellifera subspecies. Part 1 (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2018. No.1. P. 20-22.) АННОТАЦИЯ. Виды пчел A. cerana и A. mellifera географически были разобщены более миллиона назад и до активного вмешательства человека в последние сотни лет не контактировали друг с другом. Независимо друг от друга A. cerana и A. mellifera подразделились на десятки подвидов, адаптированных к широкому спектру климатических условий от 30° ю. ш. до 47° с. ш. Старого Света. Вероятно, широкое разнообразие природно-климатических условий привело к формированию 30 подвидов. Значительный прогресс в микроэволюции медоносной пчелы A. mellifera был достигнут в плейстоценовый ледниковый период, когда популяции пчел были изолированы в многочисленных рефугиях в течение 100 тыс. лет. В статье рассмотрены гипотезы широкой экспансии вида и формирования подвидов медоносной пчелы на основе данных полиморфизма ядерной и митохондриальной ДНК. --- ANNOTATION. The bee species A. cerana and A. mellifera geographically diverged more than millions years ago, and they did not contact each other before active human transporting in the last hundreds of years. Regardless of each other, A. cerana and A. mellifera subdivided into dozens of subspecies, which adapted to a wide range of climatic conditions from 30° of the south latitude to 47° of the north latitude of the Old World. Probably, a wide diversity of natural and climatic conditions led to the origin of 30 subspecies. Significant progress in the microevolution of the honeybee A. mellifera was achieved in the Pleistocene glacial period, when populations of bees were isolated in numerous refugia within 100 thousand years. In the article considered the hypotheses of wide expansion of species and of origin of honeybee subspecies based on polymorphism of nuclear and mitochondrial DNA.
 217. Ilyasov R., Noh G.-R., Kim D.-I., Lim S.-H., Song J.-H., Kwon H.-W. Dark forest honeybees Apis mellifera mellifera L. in the Ural and Volga region. Materials of the 32th Conference of the Apicultural Society of Korea. Nonsan, Korea. 24-25.10.2017. P. 51. Ильясов Р., Нох Г.-Р., Ким Д.-И., Лим С.-Х., Сонг Д.-Х., Квон Х.-В. Темные лесные медоносные пчелы Apis mellifera mellifera L. на Урале и в Поволжье. Материалы 32-й конференции общества пчеловодов Кореи. Нонсан, Корея. 24-25.10.2017. C. 51.
Ilyasov R., Noh G.-R., Kim D.-I., Lim S.-H., Song J.-H., Kwon H.-W. Dark forest honeybees Apis mellifera mellifera L. in the Ural and Volga region. Materials of the 32th Conference of the Apicultural Society of Korea. Nonsan, Korea. 24-25.10.2017. P. 51. Abstract. Dark forest bee Apis mellifera mellifera is an aboriginal subspecies for the Nordic countries and has an area extending up to 47° of North Latitude. Despite the fact that the dark forest bee became known for its highly developed protective behavior, it is most preferable for breeding in most parts of Northern and Central Russia. The gene pool of a dark forest bee is currently threatened because of mass hybridization with imported southern subspecies A. m. carpathica and A. m. caucasica. Based on molecular population genetics analysis of 9 microsatellite loci (AP243, 4A110, A24, A8, A43, A113, A88, AP049, A28) in nuclear genome of honeybees A. mellifera and analysis a nucleotide sequences polymorphism of following loci: ND2 mtDNA, COI-COII mtDNA, VG of nuclear DNA, we developed criteria for identification of native bee subspecies A. m. mellifera. Using method of cluster analysis, we constructed dendrograms and median networks, which allow differentiating of honeybee subspecies from different evolutionary lineages. We researched a level of introgressed genes from southern populations in the dark forest bee populations in the Ural and Volga region. Now we began a molecular genetic research in Korean Apis cerana populations in the Sensory Neurobiology and Biomodeling Laboratory (SNBL) of Incheon National University. Our aims is: comparing genomes A. mellifera and A. cerana; research of expression of immune-related genes in A. cerana; make a population genomics research of A. mellifera and A. cerana. --- Ильясов Р., Нох Г.-Р., Ким Д.-И., Лим С.-Х., Сонг Д.-Х., Квон Х.-В. Темные лесные медоносные пчелы Apis mellifera mellifera L. на Урале и в Поволжье. Материалы 32-й конференции общества пчеловодов Кореи. Нонсан, Корея. 24-25.10.2017. C. 51. Аннотация. Темная лесная пчела Apis mellifera mellifera является аборигенным подвидом для северных стран и имеет ареал, распространения до 47 ° северной широты. Несмотря на то, что темная лесная пчела стала известна своим высокоразвитым защитным поведением, она наиболее предпочтительна для разведения в большинстве районов Северной и Центральной России. Генетический бассейн темной лесной пчелы в настоящее время находится под угрозой из-за массовой гибридизации с импортированными южными подвидами A. m. carpathica и A. m. кавказский. На основе молекулярного популяционного генетического анализа 9 микросателлитных локусов (AP243, 4A110, A24, A8, A43, A113, A88, AP049, A28) в ядерном геноме медоносных пчел A. mellifera и анализ полиморфизма нуклеотидных последовательностей следующих локусов: ND2 мДНК, COI-COII мДНК, VG ядерной ДНК, мы разработали критерии идентификации родственных подвидов пчел A. m. mellifera. Используя метод кластерного анализа, мы построили дендрограммы и медианные сети, которые позволяют дифференцировать подвиды медоносных пчел от разных эволюционных линий. Мы исследовали уровень интрогрессированных генов из южных популяций в популяциях темных лесных пчел в Урале и Поволжье. Сейчас мы начали молекулярно-генетическое исследование в корейских популяциях Apis в Лаборатории сенсорной нейробиологии и биомоделирования (СНБЛ) Национального университета Инчхон. Наши цели: сравнение геномов A. mellifera и A. cerana; исследование экспрессии генов, связанных с иммунной системой, в A. cerana; провести популяционно геномные исследования A. mellifera и A. cerana.
 216. Jung J., Kim D. I., Ilyasov R., Kim K., Kwon H. W. Comparative study of olfactory learning and memory in Apis cerana and Apis mellifera foragers. Journal of Apiculture (Korea). 2017. V. 32. No.4. P. 275~280. DOI: 10.17519/apiculture.2017.11.32.4.275. Юнг Дж., Ким Д. И., Ильясов Р., Ким К., Квон Х. В. Сравнительное изучение обонятельного обучения и памяти в фуражирующих особях Apis cerana и Apis mellifera. Журнал пчеловодства (Корея). 2017. V. 32. No. 4. P. 275-280. DOI: 10.17519/apiculture.2017.11.32.4.275.
Jung J., Kim D. I., Ilyasov R., Kim K., Kwon H. W. Comparative study of olfactory learning and memory in Apis cerana and Apis mellifera foragers. Journal of Apiculture (Korea). 2017. V. 32. No.4. P. 275~280. DOI: 10.17519/apiculture.2017.11.32.4.275. Annotation. The honeybee is an important invertebrate model organism for reward on learning and memory research. Its value as a model organism in this area is rooted in its impressive capacity for learning and memory formation. Many lines of research have been reported on learning and memory in the last few decades. However, most research on learning and memory in honeybees has been performed in the Western honeybee, Apis mellifera. Therefore, the cognitive capabilities in the Eastern honeybee, Apis cerana remain obscure, despite their biological and economical importance. In order to understand the differences of learning and memory performance in the two species of honeybees, we investigated classical olfactory conditioning according to an appetitive Pavlovian conditioning paradigm based on the olfactory conditioning of the proboscis extension response (PER). Our present study demonstrated that learning and memory performance was different between two honeybee species. During the acquisition phase, there was no statistical difference between two species. In the retention phase, A. cerana was significantly better on olfactory learning and memory than that of A. mellifera after 1 hour. On the other hand, A. mellifera showed higher learning scores than A. cerana after 24 hours. These findings extend our understandings of mechanisms underlying learning and memory capabilities, which is an important basis for the further study of behavioral responses to various ecological and biological signals in two closely related honeybee species. --- Юнг Дж., Ким Д. И., Ильясов Р., Ким К., Квон Х. В. Сравнительное изучение обонятельного обучения и памяти в фуражирующих особях Apis cerana и Apis mellifera. Журнал пчеловодства (Корея). 2017. V. 32. No. 4. P. 275-280. DOI: 10.17519/apiculture.2017.11.32.4.275. Аннотация. Медоносная пчела является важным организмом модели беспозвоночных для вознаграждения за обучение и память исследование. Его ценность как модельного организма в этой области уходит своими впечатляющими возможностями для обучения и формирование памяти. Сообщалось о многих исследованиях в области обучения и памяти в последние несколько десятилетий. Однако большинство исследований по изучению и памяти у пчел было выполненный в западной медоносной пчеле, Apis mellifera. Таким образом, когнитивные способности в Восточной пчела, Apis cerana остаются неясными, несмотря на их биологическое и экономическое значение. В порядке для понимания различий в обучении и производительности памяти у двух видов пчел, мы исследовали классическое обонятельное кондиционирование в соответствии с аппетитным павловским кондиционированием парадигмы, основанной на обонятельном обучении ответа на растяжение хобота (PER). наш настоящее исследование показало, что обучение и производительность памяти различаются между двумя виды медоносных пчел. На этапе приобретения статистическая разница между двумя виды. В фазе удержания A. cerana значительно улучшилось при обонятельном обучении и памяти чем у A. mellifera через 1 час. С другой стороны, A. mellifera показал более высокие оценки обучения чем A. cerana через 24 часа. Эти выводы расширяют наше понимание механизмов, лежащих в основе обучения и памяти, что является важной основой для дальнейшего изучения поведенческих ответы на различные экологические и биологические сигналы у двух близких видов медоносных пчел.
 215. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Основные методы идентификации подвидов пчел Apis mellifera. Биомика. 2017. Т.9. № 2. С. 71-82. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Basic methods of identification of honeybee subspecies Apis mellifera (translation). Biomics. 2017. V. 9. No. 2. P. 71-82.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Основные методы идентификации подвидов пчел Apis mellifera. Биомика. 2017. Т.9. № 2. С. 71-82. Аннотация. Медоносная пчела является важнейшим фактором, формирующим посредством опыления внешнюю и внутреннюю структуру биоценозов. Для каждого биоценоза имеет значение не только количество пчел, но и их особенности, которые, в первую очередь, определяются таксономической принадлежностью. Это связано с тем, что разные подвиды пчел имеют разное предпочтение к видам опыляемых растений. Для сохранения чистопородного генофонда подвидов пчел необходима точная идентификация таксономической принадлежности семей пчел. Нами описаны основные методы идентификации таксономической принадлежности семей пчел. Наиболее перспективными для сохранения чистопородных генофондов подвидов медоносной пчелы являются методы анализа однонуклеотидного полиморфизма SNP. --- Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Basic methods of identification of honeybee subspecies Apis mellifera (translation). Biomics. 2017. V. 9. No. 2. P. 71-82. Annotation. The honey bee is the most important factor that forms the external and internal structure of biocenoses through pollination. For each biocenosis is important not only the number of bees, but also their traits, which, in first is determined by their taxonomic affiliation. This is due to the fact that different subspecies of bees have a different preference for the species of plants. To preserve a purebred gene pool of honeybee subspecies, precise identification of the taxonomic belonging of honeybee colonies is necessary. We have described a methods of identification of taxonomic affiliation of honeybee colonies are considered. The most promising for the conservation of purebred gene pools of honeybee subspecies are methods of the analysis of single nucleotide polymorphisms SNPs.
 214. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Макро- и микроэволюция медоносной пчелы Apis mellifera. Биомика. 2017. Т.9. № 2. С. 60-70. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Macro- and microevolution of honeybee Apis mellifera (translation). Biomics. 2017. V. 9. No. 2. P. 60-70.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Макро- и микроэволюция медоносной пчелы Apis mellifera. Биомика. 2017. Т.9. № 2. С. 60-70. Аннотация. Медоносная пчела Apis mellifera L. это единственный вид общественных насекомых, который повсеместно разводится человеком. Кроме медоносной пчелы существуют такие виды пчел, как, восковая пчела Apis cerana, малая индийская пчела Apis florea, гигантская индийская пчела Apis dorsata, обитающие в Юго-Восточной Азии. Близкородственные виды пчел A. cerana и A. mellifera дивергировали аллопатрически от 500 тыс. до 1,3 млн. лет назад, и в течение этого времени не контактировали, в результате чего приобрели устойчивую репродуктивную изоляцию. Таким образом геномы этих видов надежно защищены, но угроза конкурентного вытеснения A. cerana существует. В последние 100 лет пчела медоносная A. mellifera активно завозится в Азию и постепенно вытесняет A. cerana и A. florea. Независимо друг от друга у пчел видов A. cerana и A. mellifera сформировалось подвиды под действием широкого диапазона условий окружающей среды. Нами представлены основные гипотезы экспансии A. mellifera и формирования подвидов. Несмотря на то, что A. mellifera более конкурентоспособна по сравнению с A. cerana, эта пчела в результате внутривидовой гибридизации, подвержена угрозе потери биоразнообразия генофонда и приспособленности к условиям среды обитания. --- Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Macro- and microevolution of honeybee Apis mellifera (translation). Biomics. 2017. V. 9. No. 2. P. 60-70. Annotation. The honeybee Apis mellifera L. is the only species of social insect that is bred everywhere by man. Besides the honeybee, there are bee species such as, the wax bee Apis cerana, the small Indian bee Apis florea, the giant Indian bee Apis dorsata, inhabiting Southeast Asia. The close related species of A. cerana and A. mellifera diverged allopatrically from 500,000 to 1.3 million years ago, and during this time they were not contacted, resulting in a stable reproductive isolation. Thus, the genomes of these species are reliably protected, but the threat of competitive displacement of A. cerana exists. At the last 100 years, honeybee A. mellifera is actively imported to Asia and gradually displaces A. cerana and A. florea. Regardless of each other, A. cerana and A. mellifera species were formed subspecies as a result of habitat in a wide range of conditions. We have presented the main hypotheses of the expansion of A. mellifera and the origin of subspecies. Despite the fact that A. mellifera is more competitive than A. cerana, this honeybee species is subject to the threat of loss of biodiversity of the gene pool and adaptation to environmental conditions as a result of intraspecific hybridization.
 213. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Преимущества темной лесной пчелы Apis mellifera mellifera и ее значимость для России. Биомика. 2017. Т.9. № 2. С. 83-90. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Advantages of the dark forest bee Apis mellifera mellifera and its importance for Russia (translation). Biomics. 2017. V. 9. No. 2. P. 83-90.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Преимущества темной лесной пчелы Apis mellifera mellifera и ее значимость для России. Биомика. 2017. Т.9. № 2. С. 83-90. Аннотация. Темная лесная пчела Apis mellifera mellifera это аборигенный подвид для стран Северной Европы и имеет ареал, распространяющийся до 47° с.ш. Несмотря на то, что темная лесная пчела известна своим сильно развитым защитным поведением, она является наиболее предпочтительной для разведения на большей части территории Северной и Центральной России. Это связано с тем, что темная лесная пчела способна успешно, без ущерба для своего здоровья и без лишних потерь пережить без облета длительный и морозный зимний период в течение более 6 месяцев. Такими уникальными качествами не обладает ни один из известных подвидов пчел. Однако генофонд темной лесной пчелы на данный момент находится под угрозой исчезновения в результате массовой гибридизации с импортируемыми южными подвидами A. m. carpathica и A. m. caucasica. В данной статье описаны наиболее ценные качества темной лесной пчелы, ее роль для сельского хозяйства России и причины сокращения численности семей. --- Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Advantages of the dark forest bee Apis mellifera mellifera and its importance for Russia (translation). Biomics. 2017. V. 9. No. 2. P. 83-90. Annotation. Dark forest bee Apis mellifera mellifera is an aboriginal subspecies for the Nordic countries and has an area extending up to 47° N.W. Despite the fact that the dark forest bee became known for its highly developed protective behavior, it is most preferable for breeding in most parts of Northern and Central Russia. This is due to the fact that a dark forest bee is capable of successfully surviving a long and frosty winter period for more than 6 months without damaging its health and without unnecessary losses without flying around. Such unique qualities are not possessed by any of the known subspecies of honeybees. However, the gene pool of a dark forest bee is currently threatened with extinction as a result of mass hybridization with imported southern subspecies A. m. carpathica and A. m. caucasica. This article describes the most valuable qualities of a dark forest bee, its role for Russian agriculture and the reasons for the decline in the number of colonies.
 212. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Молекулярно-генетические и биохимические методы оценки таксономической принадлежности семей пчел. Часть 2. Пчеловодство. 2017. № 8. С. 23-26. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Molecular-genetic and biochemical methods of assessing of the taxonomic status of the honeybee colonies. Part 2 (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2017. No.8. P. 23-26.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Молекулярно-генетические и биохимические методы оценки таксономической принадлежности семей пчел. Часть 2. Пчеловодство. 2017. № 8. С. 23-26. Аннотация. В процессе аллопатрической эволюции сформировалось 30 подвидов медоносной пчелы Apis mellifera L. Под влиянием природных и антропогенных факторов изоляция географических подвидов пчел была нарушена и аборигенным генофондам подвидов стала угрожать опасность интрогрессии и замещения геномов. Сохранение аборигенных генофондов медоносной пчелы представляет большее значение для успешного пчеловодства. Для сохранения чистопородного генофонда подвидов пчел необходима точная идентификация таксономической принадлежности семей пчел. В статье представлены возможности молекулярногенетических и биохимической методов для оценки таксономической принадлежности семей пчел. Наиболее перспективными и информативными при оценке таксономической принадлежности пчел являются методы на основе анализа однонуклеотидного полиморфизма (SNP). --- Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Molecular-genetic and biochemical methods of assessing of the taxonomic status of the honeybee colonies. Part 2 (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2017. No.8. P. 23-26. Annotation. In the process of allopatric evolution, 30 subspecies of the honeybee Apis mellifera L. were formed. Under the influence of natural and anthropogenic factors, the isolation of geographical subspecies of honeybees was violated and the aboriginal gene pools of subspecies became threatened with introgression and genome substitution. For humans the preservation of indigenous gene pool of honeybees has greater importance for successful and sustained beekeeping. To preserve a purebred gene pool of honeybee subspecies, correct identification of the taxonomic belonging of honeybee colonies is necessary. The article presents the possibilities of molecular-genetic and biochemical methods for assessing the taxonomic affiliation of honeybee colonies. The most promising and informative in assessing the taxonomic affiliation of honeybees are methods based on the analysis of single nucleotide polymorphism (SNP).
 211. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Молекулярно-генетические и биохимические методы оценки таксономической принадлежности семей пчел. Часть 1. Пчеловодство. 2017. № 7. С. 13-16. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Molecular-genetic and biochemical methods of assessing of the taxonomic status of the honeybee colonies. Part 1 (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2017. No.7. P. 13-16.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Молекулярно-генетические и биохимические методы оценки таксономической принадлежности семей пчел. Часть 1. Пчеловодство. 2017. № 7. С. 13-16. Аннотация. В процессе аллопатрической эволюции сформировалось 30 подвидов медоносной пчелы Apis mellifera L. Под влиянием природных и антропогенных факторов изоляция географических подвидов пчел была нарушена и аборигенным генофондам подвидов стала угрожать опасность интрогрессии и замещения геномов. Сохранение аборигенных генофондов медоносной пчелы представляет большее значение для успешного пчеловодства. Для сохранения чистопородного генофонда подвидов пчел необходима точная идентификация таксономической принадлежности семей пчел. В статье представлены возможности молекулярногенетических и биохимической методов для оценки таксономической принадлежности семей пчел. Наиболее перспективными и информативными при оценке таксономической принадлежности пчел являются методы на основе анализа однонуклеотидного полиморфизма (SNP). --- Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Molecular-genetic and biochemical methods of assessing of the taxonomic status of the honeybee colonies. Part 1 (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2017. No.7. P. 13-16. Annotation. In the process of allopatric evolution, 30 subspecies of the honeybee Apis mellifera L. were formed. Under the influence of natural and anthropogenic factors, the isolation of geographical subspecies of honeybees was violated and the aboriginal gene pools of subspecies became threatened with introgression and genome substitution. For humans the preservation of indigenous gene pool of honeybees has greater importance for successful and sustained beekeeping. To preserve a purebred gene pool of honeybee subspecies, correct identification of the taxonomic belonging of honeybee colonies is necessary. The article presents the possibilities of molecular-genetic and biochemical methods for assessing the taxonomic affiliation of honeybee colonies. The most promising and informative in assessing the taxonomic affiliation of honeybees are methods based on the analysis of single nucleotide polymorphism (SNP).
 210. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Семь причин смертности семей пчелы Apis mellifera mellifera в России. Пчеловодство. 2017. № 9. С. 10-14. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Seven causes of mortality of the dark forest honeybee Apis mellifera mellifera colonies in Russia (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2017. No.9. P. 10-14.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Семь причин смертности семей пчелы Apis mellifera mellifera в России. Пчеловодство. 2017. № 9. С. 10-14. Аннотация. Пчелы играют исключительную роль в поддержании биологического и таксономического разнообразия природных и антропогенных экосистем в результате опылительной деятельности, а также в обеспечении человека пищей и биологически активными и лекарственными веществами. Темная лесная пчела Apis mellifera mellifera имеет высокую значимость в пчеловодстве и сельском хозяйстве России. Этот подвид пчел идеально приспособлен к жизни и продуктивной деятельности в природно-климатических условиях Центральной и Северной России. Однако в России происходит повышение смертности и сокращение общей численности семей пчел, в частности темной лесной пчелы. В данной статье представлено семь наиболее значимых факторов, приводящих к повышению смертности и снижению численности семей пчел в России. --- Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Seven causes of mortality of the dark forest honeybee Apis mellifera mellifera colonies in Russia (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2017. No.9. P. 10-14. Annotation. Honeybees play an exceptional role in maintaining the biological and taxonomic diversity of natural and anthropogenic ecosystems as a result of pollination activities, as well as in providing humans with food and biologically active and medicinal substances. The dark forest honeybee Apis mellifera mellifera has high significance in the beekeeping and agriculture of Russia. This subspecies of honeybees is ideally adapted to life and productive activities in the natural and climatic conditions of Central and Northern Russia. However, an increase of mortality and a reduction of the total number of honeybee colonies there is in Russia, in particular, of the dark forest honeybee. This article presents the seven most significant factors leading to an increase of mortality and a decrease of the number of honeybee colonies in Russia.
 209. Ильясов Р. А., Поскряков А. В., Николенко А. Г. Генофонд темной лесной пчелы A. m. mellifera бурзянской популяции. Материалы Международной научно-практической конференции по пчеловодству "Современные проблемы пчеловодства". ФГБОУ ВО «Чеченский государственный университет»: Грозный. 2017 (15–18 мая 2017 г.). С. 120-123. (Ilyasov R. A., Poskryakov A. V., Nikolenko A. G. The gene pool of the dark forest bee A. m. mellifera burzyansky population. Materials of the International scientific and practical conference on beekeeping "Modern problems of beekeeping". FGBOU VO "Chechen State University": Grozny. 2017 (May 15-18, 2017). P. 120-123.).
Ильясов Р. А., Поскряков А. В., Николенко А. Г. Генофонд темной лесной пчелы A. m. mellifera бурзянской популяции. Материалы Международной научно-практической конференции по пчеловодству "Современные проблемы пчеловодства". ФГБОУ ВО «Чеченский государственный университет»: Грозный. 2017 (15–18 мая 2017 г.). С. 120-123. (Ilyasov R. A., Poskryakov A. V., Nikolenko A. G. The gene pool of the dark forest bee A. m. mellifera burzyansky population. Materials of the International scientific and practical conference on beekeeping "Modern problems of beekeeping". FGBOU VO "Chechen State University": Grozny. 2017 (May 15-18, 2017). P. 120-123.). Аннотация. Проведен мониторинг генофонда популяции темной лесной пчелы Бурзянского района Республики Башкортостан на основе изучения полиморфизма 9 микросателлитных локусов яДНК. Выполнена оценка уровня интрогрессии «южных» генов по годам и по отдельным выборкам для разных годов исследований. Показана высокая стабильность и чистота генофонда популяции темной лесной пчелы Бурзянского района со средним уровнем интрогрессии «южных» генов 2,7%. Представлена высокая эффективность сохранения чистоты генофонда A. m. mellifera на территории природо-охранных организаций - заповедников, национальных парков и заказников. (Abstract. Carried out monitoring of the population's gene pool dark forest bees burzyansky district of the Republic of Bashkortostan on the basis of study of polymorphism of 9 microsatellite loci, agnc. Assess the level of introgression of the "southern" genes by year and by individual sample size for different study years. The high stability and the purity of the gene pool of the population of the dark forest bees burzyansky district with the average level of introgression of the "southern" genes of 2.7%. Presents high efficiency maintain the purity of the gene pool of A. m. mellifera on the territory of environmental organizations - nature reserves, national parks and sanctuaries.)
 208. Ilyasov R. A., Poskryakov A. V., Nikolenko A. G. The population of the purebred dark European honeybees Apis mellifera mellifera in the Urals and the Volga region. NordBi-Aktuellt (Sweden). 2017. No.1. P. 14-15.
The population of the purebred dark European honeybees Apis mellifera mellifera in the Urals and the Volga region. (Популяция чистопородной темной лесной пчелы Apis mellifera mellifera на Урале и в Поволжье). Ilyasov R. A., Poskryakov A. V., Nikolenko A. G. The population of the purebred dark European honeybees Apis mellifera mellifera in the Urals and the Volga region. NordBi-Aktuellt (Sweden). 2017. No.1. P. 14-15. Abstract The local populations of the dark European honeybees Apis mellifera mellifera from the Urals and the Volga region were examined in this work. The genetic analysis of populations and colonies was performed based on the polymorphism of 9 microsatellite loci of the nuclear genome. We found some level of the introgression in the native genetic pool of the A.m.mellifera in the Urals and the Volga Region by hybridization with introduced from Caucasus a “southern” subspecies Apis mellifera carpatica and Apis mellifera caucasica. The greatest proportion of the remaining indigenous gene pool of A. m. mellifera is the core of the gene pool of the population of the subspecies A. m. mellifera, which distributed over the entire territory of Perm krai and the north of the Republic of Bashkortostan. For the remaining population of A. m. mellifera of the Urals and the Volga region. Finally, we found biggest reserves of native gene pool of A. m. mellifera in the Urals and Volga region, which contain about thousand colonies of pure dark European honeybees. Vi har i nordbiprojektet ibland frågat oss: hur står det till med det nordiska biet i Ryssland? Det har ju funnits ända bort till Uralbergen, men hur är det idag. Nu har vi fått kontakt via Sicamm med bl a Rustem Ilyasov, som forskar om det nordiska biets utbredning i Ryssland och även fått hans dokktorsavhandling, som här finns i väsentliuga delar. Hoppas inte det engelska språket ska vara ett hinder. В этой работе были изучены местные популяции темных европейских пчел Apis mellifera mellifera с Урала и Поволжья. Генетический анализ популяций и колоний проводился на основе полиморфизма 9 микросателлитных локусов ядерного генома. Мы обнаружили некоторый уровень интрогрессии в природном генетическом бассейне A.m.mellifera на Урале и Поволжье путем гибридизации с введенным с Кавказа «южным» подвидом Apis mellifera carpatica и Apis mellifera caucasica. Наибольшая доля оставшегося местного генофонда A. m. Mellifera является ядром генофонда популяции подвидов A. m. mellifera, которые распространялись по всей территории Пермского края и севера Республики Башкортостан. Для сохранения популяции A. m. mellifera Урала и Поволжья. Наконец, мы обнаружили самые большие запасы природного генофонда A. m. mellifera на Урале и в Поволжье, в которых содержится около тысячи колоний чистопородных темных европейских пчел.
 207. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. The genome of the honey bee Apis mellifera in comparison with fruit fly Drosophila melanogaster. In book: The value of biodiversity of bees in maintaining homeostasis of ecosystems / Ed. V.A. Sysuev, A.Z. Brandorf, Kirov: Agricultural Research Institute of the North–East, 2017. 308 p. P. 77 - 82. ISBN 978-5-7352-0149-6.
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. The genome of the honey bee Apis mellifera in comparison with fruit fly Drosophila melanogaster. In book: The value of biodiversity of bees in maintaining homeostasis of ecosystems / Ed. V.A. Sysuev, A.Z. Brandorf, Kirov: Agricultural Research Institute of the North–East, 2017. 308 p. P. 77 - 82. ISBN 978-5-7352-0149-6. Ильясов Р. А., Поскряков А. В., Николенко А. Г. Геном медоносной пчелы Apis mellifera в сравнении с плодовой мушкой Drosophila melanogaster. В книге: Роль биоразнообразия пчелиных в поддержании гомеостаза экосистем / ред. В. А. Сысуева, А. З. Брандорф. Киров: НИИСХ Северо–Востока, 2017. 308 с. С. 77 - 82. ISBN 978-5-7352-0149-6. The analisis of the nuclear and the mitochondrial genomes of the honey bee Apis mellifera in comparison with the well–annotated, finished fruit fly Drosophila melanogaster genome was presented in this article. The nuclear genome of the honey bee has about 245 millions b. p., which distributed in 16 chromosomes and contains about 10 thousands genes. The mitochondrial genome of the A. mellifera has about 16 thousands b. p., which located in mitochondrions and contains 35 genes. The nuclear genome of the fruit fly has about 144 millions b. p., which distributed in 4 chromosomes and contains about 17 thousands genes. The mitochondrial genome of the D. melanogaster has about 19 thousands b. p., which located in mitochondrions and contains 37 genes. В статье представлен сравнительный анализ ядерного и митохондриального геномов медоносной пчелы Apis mellifera и плодовой мушки Drosophila melanogaster. Ядерный геном медоносной пчелы имеет размер около 245 миллионов п. н., который распределен в 16 хромосом и содержит около 10 тысяч генов. Митохондриальный геном A. mellifera имеет размер около 16 тысяч п. н., который расположен в митохондриях и содержит 35 генов. Ядерный геном плодовой мушки имеет размер около 144 миллионов п. н., который дифференцирован в 4-х хромосомах и содержит около 17 тысяч генов. Митохондриальный геном D. melanogaster имеет размер около 19 тысяч п. н., который находится в митохондриях и содержит 37 генов.
 206. Ильясов Р. А., Поскряков А. В., Николенко А. Г. Сохранение генофонда темной лесной пчелы бурзянской популяции A. m. mellifera. В книге: Роль биоразнообразия пчелиных в поддержании гомеостаза экосистем / ред. В. А. Сысуева, А. З. Брандорф. Киров: НИИСХ Северо–Востока, 2017. 308 с. С. 46 - 50. ISBN 978-5-7352-0149-6.
Ильясов Р. А., Поскряков А. В., Николенко А. Г. Сохранение генофонда темной лесной пчелы бурзянской популяции A. m. mellifera. В книге: Роль биоразнообразия пчелиных в поддержании гомеостаза экосистем / ред. В. А. Сысуева, А. З. Брандорф. Киров: НИИСХ Северо–Востока, 2017. 308 с. С. 46 - 50. ISBN 978-5-7352-0149-6. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. A conservation of the gene pool of the burzyan population of dark forest bee A. m. mellifera. In book: The value of biodiversity of bees in maintaining homeostasis of ecosystems / Ed. V.A. Sysuev, A.Z. Brandorf, Kirov: Agricultural Research Institute of the North–East, 2017. 308 p. P. 46 - 50. ISBN 978-5-7352-0149-6. Проведен мониторинг генофонда популяции темной лесной пчелы Бурзянского района Республики Башкортостан на основе изучения полиморфизма 9 микросателлитных локусов яДНК. Выполнена оценка уровня интрогрессии «южных» генов по годам и по отдельным выборкам для разных годов исследований. Показана высокая стабильность и чистота генофонда популяции темной лесной пчелы Бурзянского района со средним уровнем интрогрессии «южных» генов 2.7%. Представлена высокая эффективность сохранения чистоты генофонда A. m. mellifera на территории природоохранных организаций — заповедников, национальных парков и заказников. Monitoring of the gene pool of the dark forest bee population of the Burzyansky district of the Republic of Bashkortostan based on the study of a polymorphism of 9 microsatellite loci of the nuclear DNA. The level of «southern» genes introgression for samples by years and for every samples researches in different years was evaluated. The high stability and purity of the gene pool of a of dark forest bees population of the Burzyansky district with average level of introgression of «southern» genes 2.7% was shown. The high efficiency of the conservation of the gene pool purity of the A. m. mellifera on the territory of a preserving nature organizations - reserves, national parks and sanctuaries.
 205. Ильясов Р.А. Генетическая структура популяции и филогенетическое положение темной лесной пчелы Apis mellifera mellifera L. Урала и Поволжья. Диссертация на соискание ученой степени доктора биологических наук. Уфа. 2016. 326 с.
Ильясов Р.А. Генетическая структура популяции и филогенетическое положение темной лесной пчелы Apis mellifera mellifera L. Урала и Поволжья. Диссертация на соискание ученой степени доктора биологических наук. Уфа. 2016. 326 с. (Ilyasov R.A. The genetic structure of population and phylogenetic position of the dark European bees Apis mellifera mellifera L. in the Urals and Volga region. Dissertation for the degree of Doctor of Biological Sciences. Ufa. 2016. P. 326.). На основе сравнительного анализа нуклеотидных последовательностей генов ядерного и митохондриального геномов была выявлена высокая информативность для филогенетических реконструкций 7 генов мтДHK (ND2, ND4, ND4L, ND5, ND6, COI, COIII) и гена вителлогенина VG яДHK медоносной пчелы. В результате сравнительного анализа нуклеотидных последовательностей локуса COI-COII мтДHK было показано, что уральская и поволжская популяции темной лесной пчелы отличаются от европейских популяций A. m. mellifera по SNP 912 G>A относительно референсной последовательности Nc001566 в Генбанке. Обнаружены SNPs митохондриального (SNP 816 C>T в гене ND2 мтДHK относительно референсной последовательности Nc001566) и ядерного (22 SNPs и 2 двойные SNPs 2887-2888 AA>TC и 4508-4509 GG>AA в гене VG яДHK относительно референсной последовательности Nс007073) геномов, позволяющие проводить селекцию темной лесной пчелы A. m. mellifera. Подтверждено вхождение в эволюционную ветвь М и тесное генетическое родство темной лесной пчелы уральской популяции с европейскими популяциями A. m. mellifera на основе сравнительного анализа нуклеотидной последовательности гена VG яДHK, гена ND2 мтДHK и локуса COI-COII мтДHK. На основе геногеографического анализа интрогрессии “южных” генов по ядерному (9 микросателлитных локусов) и митохондриальному (локус COI-COII) геномам на Урале и в Поволжье обнаружены и локализованы ареалы пяти сохранившихся популяций (резерватов) темной лесной пчелы A. m. mellifera (бурзянская, татышлинская, южно-прикамская, вишерская, камбарская). На основе анализа полиморфизма 9 микросателлитных локусов яДHK были рассчитаны генетические стандарты для популяции (Ho=0.24, Hs=0.23, Ht=0.28, Fis=0.06, Fit=0.14, Fst=0.17) и семьи (Ho=0.20, Hs=0.16, Ht=0.15, Fis=0.23, Fit=0.35, Fst=0.11) темной лесной пчелы A. m. mellifera. Анализ полиморфизма 9 микросателлитных локусов яДHK и локуса COI-COII мтДHK позволил определить уровень интрогрессии “южных” генов в популяции темной лесной пчелы Урала и Поволжья. Процесс гибридизации A. m. mellifera происходил в результате интродукции пчелиных семей других подвидов из южных регионов России. На основе полиморфизма 9 микросателлитных локусов яДHK была предложена методика селекции семей темной лесной пчелы с интрогрессией “южных” генов не более 5%, и генетическими показателями, характерными для чистопородных семей A. m. mellifera (Ho ≤ 0.30, Hs ≤ 0.30, Ht ≤ 0.30, Fis ≤ │0.45│, Fit ≤ │0.55│, Fst ≥ │0.11│). Качество селектируемого материала будет определяться числом показателей, которым соответствует анализируемая семья пчел. Такая селекция позволит поддерживать генетическое и генотипическое разнообразие в рамках генетического стандарта подвида A. m. mellifera. The high informativeness of the seven mitochondrial genes (ND2, ND4, ND4L, ND5, ND6, COI, COIII) and the gene vitellogenin VG for phylogenetic reconstructions of honeybees have found based on comparative analysis of the nucleotide sequences. The populations of the dark European honeybees of the Urals and Volga region differ from the European populations of the A. m. mellifera by SNP 912 G>A relative to the reference sequence Nc001566 have showed based on a comparative analysis of the nucleotide sequences of the locus COI-COII of the mitochondrial DNA. The SNPs of the mitochondrial DNA (SNP 816 C> T in the ND2 gene of mtDNA relative to the reference sequence Nc001566) and nuclear DNA (22 SNPs and 2 double SNPs 2887-2888 AA> TC and 4508-4509 GG> AA in the VG gene of the nuclear DNA relative to the reference sequence Nc007073) which allows to select the dark European honeybees A. m. mellifera have found based on a comparative analysis of the nucleotide sequences. An including to the M evolutionary lineage of Apis mellifera and a close genetic relationship of the dark European honeybees of the Ural and Volga region populations with European populations have confirmed based on a comparative analysis of the nucleotide sequences of the gene vitellogenin VG of the nuclear DNA, of the locus COI-COII and the gene ND2 of the mitochondrial DNA. An area of the five preserved populations (reserves) of the dark European honeybees A. m. mellifera (named burzyanskaya, tatyshlinskaya, yuzhno-prikamskaya, visherskaya, kambarskaya) have found and localized based on gene geographic analysis of the introgression of “southern” genes of nuclear (9 microsatellite loci) and mitochondrial (COI-COII locus) in the the Urals and Volga region. The genetic standards of populations (Ho=0.24, Hs=0.23, Ht=0.28, Fis=0.06, Fit=0.14, Fst=0.17) and colonies (Ho=0.20, Hs=0.16, Ht=0.15, Fis=0.23, Fit=0.35, Fst=0.11) of the dark European honeybees A. m. mellifera have calculated based on a polymorphism of the 9 microsatellite loci of the nuclear genome. An analysis of the polymorphisms of the 9 microsatellite loci of the nuclear genome and of the locus COI-COII of mitochondrial DNA allows to determine the level of introgression of “southern” genes in populations of the dark European honeybees in the Urals and Volga regions. The hybridization process of A. m. mellifera occurred as a result of introduction of the honeybee’s subspecies from the Southern regions of Russia. The selection method of the dark European honeybees with introgression at most 5% and on the basis of the genetic parameters of the purebred colonies of A. m. mellifera (Ho ≤ 0.30, Hs ≤ 0.30, Ht ≤ 0.30, Fis ≤ │0.45│, Fit ≤ │0.55│, Fst ≥ │0.11│) have proposed based on the polymorphisms of the 9 microsatellite loci of the nuclear genome. The quality of the selection of honeybees can be determined by number of genetic parameters which corresponded the testing colonies to the parameters for selection above. Such genetic selection allows to save genetic and genotypic diversity in populations within the genetic standard of the subspecies A. m. mellifera.
 204. Ильясов Р.А. Генетическая структура популяции и филогенетическое положение темной лесной пчелы Apis mellifera mellifera L. Урала и Поволжья. Автореферат диссертации на соискание ученой степени доктора биологических наук. Уфа. 2016. 48 с.
Ильясов Р.А. Генетическая структура популяции и филогенетическое положение темной лесной пчелы Apis mellifera mellifera L. Урала и Поволжья. Автореферат диссертации на соискание ученой степени доктора биологических наук. Уфа. 2016. 48 с. (Ilyasov R.A. The genetic structure of population and phylogenetic position of the dark European bees Apis mellifera mellifera L. in the Urals and Volga region. Abstract of dissertation for the degree of Doctor of Biological Sciences. Ufa. 2016. P. 48.). На основе сравнительного анализа нуклеотидных последовательностей генов ядерного и митохондриального геномов была выявлена высокая информативность для филогенетических реконструкций 7 генов мтДHK (ND2, ND4, ND4L, ND5, ND6, COI, COIII) и гена вителлогенина VG яДHK медоносной пчелы. В результате сравнительного анализа нуклеотидных последовательностей локуса COI-COII мтДHK было показано, что уральская и поволжская популяции темной лесной пчелы отличаются от европейских популяций A. m. mellifera по SNP 912 G>A относительно референсной последовательности Nc001566 в Генбанке. Обнаружены SNPs митохондриального (SNP 816 C>T в гене ND2 мтДHK относительно референсной последовательности Nc001566) и ядерного (22 SNPs и 2 двойные SNPs 2887-2888 AA>TC и 4508-4509 GG>AA в гене VG яДHK относительно референсной последовательности Nс007073) геномов, позволяющие проводить селекцию темной лесной пчелы A. m. mellifera. Подтверждено вхождение в эволюционную ветвь М и тесное генетическое родство темной лесной пчелы уральской популяции с европейскими популяциями A. m. mellifera на основе сравнительного анализа нуклеотидной последовательности гена VG яДHK, гена ND2 мтДHK и локуса COI-COII мтДHK. На основе геногеографического анализа интрогрессии “южных” генов по ядерному (9 микросателлитных локусов) и митохондриальному (локус COI-COII) геномам на Урале и в Поволжье обнаружены и локализованы ареалы пяти сохранившихся популяций (резерватов) темной лесной пчелы A. m. mellifera (бурзянская, татышлинская, южно-прикамская, вишерская, камбарская). На основе анализа полиморфизма 9 микросателлитных локусов яДHK были рассчитаны генетические стандарты для популяции (Ho=0.24, Hs=0.23, Ht=0.28, Fis=0.06, Fit=0.14, Fst=0.17) и семьи (Ho=0.20, Hs=0.16, Ht=0.15, Fis=0.23, Fit=0.35, Fst=0.11) темной лесной пчелы A. m. mellifera. Анализ полиморфизма 9 микросателлитных локусов яДHK и локуса COI-COII мтДHK позволил определить уровень интрогрессии “южных” генов в популяции темной лесной пчелы Урала и Поволжья. Процесс гибридизации A. m. mellifera происходил в результате интродукции пчелиных семей других подвидов из южных регионов России. На основе полиморфизма 9 микросателлитных локусов яДHK была предложена методика селекции семей темной лесной пчелы с интрогрессией “южных” генов не более 5%, и генетическими показателями, характерными для чистопородных семей A. m. mellifera (Ho ≤ 0.30, Hs ≤ 0.30, Ht ≤ 0.30, Fis ≤ │0.45│, Fit ≤ │0.55│, Fst ≥ │0.11│). Качество селектируемого материала будет определяться числом показателей, которым соответствует анализируемая семья пчел. Такая селекция позволит поддерживать генетическое и генотипическое разнообразие в рамках генетического стандарта подвида A. m. mellifera. The high informativeness of the seven mitochondrial genes (ND2, ND4, ND4L, ND5, ND6, COI, COIII) and the gene vitellogenin VG for phylogenetic reconstructions of honeybees have found based on comparative analysis of the nucleotide sequences. The populations of the dark European honeybees of the Urals and Volga region differ from the European populations of the A. m. mellifera by SNP 912 G>A relative to the reference sequence Nc001566 have showed based on a comparative analysis of the nucleotide sequences of the locus COI-COII of the mitochondrial DNA. The SNPs of the mitochondrial DNA (SNP 816 C> T in the ND2 gene of mtDNA relative to the reference sequence Nc001566) and nuclear DNA (22 SNPs and 2 double SNPs 2887-2888 AA> TC and 4508-4509 GG> AA in the VG gene of the nuclear DNA relative to the reference sequence Nc007073) which allows to select the dark European honeybees A. m. mellifera have found based on a comparative analysis of the nucleotide sequences. An including to the M evolutionary lineage of Apis mellifera and a close genetic relationship of the dark European honeybees of the Ural and Volga region populations with European populations have confirmed based on a comparative analysis of the nucleotide sequences of the gene vitellogenin VG of the nuclear DNA, of the locus COI-COII and the gene ND2 of the mitochondrial DNA. An area of the five preserved populations (reserves) of the dark European honeybees A. m. mellifera (named burzyanskaya, tatyshlinskaya, yuzhno-prikamskaya, visherskaya, kambarskaya) have found and localized based on gene geographic analysis of the introgression of “southern” genes of nuclear (9 microsatellite loci) and mitochondrial (COI-COII locus) in the the Urals and Volga region. The genetic standards of populations (Ho=0.24, Hs=0.23, Ht=0.28, Fis=0.06, Fit=0.14, Fst=0.17) and colonies (Ho=0.20, Hs=0.16, Ht=0.15, Fis=0.23, Fit=0.35, Fst=0.11) of the dark European honeybees A. m. mellifera have calculated based on a polymorphism of the 9 microsatellite loci of the nuclear genome. An analysis of the polymorphisms of the 9 microsatellite loci of the nuclear genome and of the locus COI-COII of mitochondrial DNA allows to determine the level of introgression of “southern” genes in populations of the dark European honeybees in the Urals and Volga regions. The hybridization process of A. m. mellifera occurred as a result of introduction of the honeybee’s subspecies from the Southern regions of Russia. The selection method of the dark European honeybees with introgression at most 5% and on the basis of the genetic parameters of the purebred colonies of A. m. mellifera (Ho ≤ 0.30, Hs ≤ 0.30, Ht ≤ 0.30, Fis ≤ │0.45│, Fit ≤ │0.55│, Fst ≥ │0.11│) have proposed based on the polymorphisms of the 9 microsatellite loci of the nuclear genome. The quality of the selection of honeybees can be determined by number of genetic parameters which corresponded the testing colonies to the parameters for selection above. Such genetic selection allows to save genetic and genotypic diversity in populations within the genetic standard of the subspecies A. m. mellifera.
 203. Ильясов Р.А. Поскряков А.В. Николенко А.Г. Мониторинг (2004-2015 годы) генофонда темной лесной пчелы бурзянской популяции Apis mellifera mellifera. В сборнике научных трудов: Изучение природы Башкортостана и проблемы пчеловодства. - Вып. 5 / Под ред. Н.М. Сайфуллиной. - Уфа: Информреклама. 2016. - С. 148-161. 244 с.
Ильясов Р.А. Поскряков А.В. Николенко А.Г. Мониторинг (2004-2015 годы) генофонда темной лесной пчелы бурзянской популяции Apis mellifera mellifera. В сборнике научных трудов: Изучение природы Башкортостана и проблемы пчеловодства. - Вып. 5 / Под ред. Н.М. Сайфуллиной. - Уфа: Информреклама. 2016. - С. 148-161. 244 с. (Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Monitoring (2004 - 2015 years) of the gene pool of the burzyan population of dark forest bee A. m. mellifera. In the procedings: Investigation of the Bashkortostan nature and the challenges of the beekeeping. Editor: N.M. Saifullina. Ufa: Informreklama. 2016. V. 5. - P. 148-161. 244 p.). АННОТАЦИЯ. Проведен мониторинг генофонда популяции темной лесной пчелы Бурзянского района Республики Башкортостан с 2004 по 2015 годы на основе изучения полиморфизма 9 микросателлитных локусов яДНК. Выполнена оценка уровня интрогрессии «южных» генов по годам и по отдельным выборкам для разных годов исследований. Показана высокая стабильность и чистота генофонда популяции темной лесной пчелы Бурзянского района со средним уровнем интрогрессии «южных» генов 2,7%. Представлена высокая эффективность сохранения чистоты генофонда A. m. mellifera на территории природоохранных организаций - заповедников, национальных парков и заказников. ABSTRACT. Monitoring of the gene pool of the dark forest bee population of the Burzyansky district of the Republic of Bashkortostan was performed from 2004 to 2015 based on the study of a polymorphism of 9 microsatellite loci of the nuclear DNA. The level of «southern» genes introgression for samples by years and for every samples researches in different years was evaluated. The high stability and purity of the gene pool of a of dark forest bees population of the Burzyansky district with average level of introgression of «southern» genes 2,7% was shown. The high efficiency of the conservation of the gene pool purity of the A. m. mellifera on the territory of a preserving nature organizations - reserves, national parks and sanctuaries.
 202. Ильясов Р.А. Поскряков А.В. Николенко А.Г. Генетический стандарт темной лесной пчелы Apis mellifera mellifera для селекции. В сборнике научных трудов: Изучение природы Башкортостана и проблемы пчеловодства. - Вып. 5 / Под ред. Н.М. Сайфуллиной. - Уфа: Информреклама. 2016. - С. 136-148. 244 с.
Ильясов Р.А. Поскряков А.В. Николенко А.Г. Генетический стандарт темной лесной пчелы Apis mellifera mellifera для селекции. В сборнике научных трудов: Изучение природы Башкортостана и проблемы пчеловодства. - Вып. 5 / Под ред. Н.М. Сайфуллиной. - Уфа: Информреклама. 2016. - С. 136-148. 244 с. (Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Genetic standard for a selection of the dark forest bee A. m. mellifera. In the procedings: Investigation of the Bashkortostan nature and the challenges of the beekeeping. Editor: N.M. Saifullina. Ufa: Informreklama. 2016. V. 5. - P. 148-161. 244 p.). АННОТАЦИЯ.В статье нами представлен молекулярно-генетический анализ популяций и семей темной лесной пчелы A. m. mellifera Урала и Поволжья в сравнении с популяциями пчел «южных» подвидов A. m. caucasica и A. m. carpatica Кавказа и Карпат на основе полиморфизма 9 микросателлитных локусов яДHK. Нами получены генетические характеристики для популяции (Ho=0,24, Hs=0,23, Ht=0,28, Fis=0,06, Fit=0,14, Fst=0,17) и семьи (Ho=0,20, Hs=0,16, Ht=0,15, Fis=0,23, Fit=0,35, Fst=0,11) темной лесной пчелы A. m. mellifera и предложена методика селекции семей темной лесной пчелы с интрогрессией “южных” генов не более 5%, и генетическими показателями, характерными для чистопородных семей A. m. mellifera (Ho ≤ 0,30, Hs ≤ 0,30, Ht ≤ 0,30, Fis ≤ │0,45│, Fit ≤ │0,55│, Fst ≥ │0,11│).Abstract. In this article we have carried out a molecular genetic analysis of the populations and colonies of the dark forest bee A. m. mellifera from the Urals and the Volga region in comparison with populations of the bees of “southern” subspecies A. m. caucasica and A. m. carpatica from the Caucasus and the Carpathians based on the polymorphism 9 microsatellite loci of the nuclear DNA. We was proposed in this article the genetic characteristics of the population (Ho=0,24, Hs=0,23, Ht=0,28, Fis=0,06, Fit=0,14, Fst=0,17) and the colony (Ho=0,20, Hs=0,16, Ht=0,15, Fis=0,23, Fit=0,35, Fst=0,11) of the dark forest bee A. m. mellifera were calculated and the method of selection of the dark forest bee colonies with introgression of "southern" less than 5% and genetic characteristic of thoroughbred colonies A. m. mellifera (Ho ≤ 0,30, Hs ≤ 0,30, Ht ≤ 0,30, Fis ≤ │0,45│, Fit ≤ │0,55│, Fst ≥ │0,11│).
 201. Ilyasov R. A., Kosarev M. N., Neal A., Yumaguzhin F. G. The Burzyan wild-hive honeybee A.m.mellifera in the South Urals. Bee Improvement and Conservation. 2016. V. 47. P. 6-8.
The Burzyan wild-hive honeybee A.m.mellifera in the South Urals (Бурзянская бортевая пчела A.m.mellifera на Южном Урале) Ilyasov R. A., Kosarev M. N., Neal A., Yumaguzhin F. G. The Burzyan wild-hive honeybee A.m.mellifera in the South Urals. Bee Improvement and Conservation. 2016. V. 47. P. 6-8. When the number of natural tree cavities declined sharply, beekeepers were forced to carfully treat the wild-hive bees more carefully. The European dark bee Apis mellifera mellifera, a unique subspecies of honeybee Apis mellifera, is evolutionar y adapted to live in the continental climate of northern Eurasia with long cold winters. Nowadays this subspecies survives only in a few isolated reservation areas. The biggest areas are in Russia: about 300.000 colonies avoided spontaneous hybridisation in the South Ural area of Republic of Bashkirostan; about 200.000 colonies in the Middle Ural area and about 250.000 colonies in Volga region of Republic of Tatarstan. We also have information about large populations of the European dark bee in the Altai region of the Republic of Udmurtia. About 99% of European dark bees in the South Urals are kept in framed hives in apiaries (Fig. 1), and about 196 in natural and artificial tree cavities. The evolution of European dark bees was synchronous with the evolution of the widely spreading lime tree Tilia cordata and therefore the main forage crop for these bees is when these trees blossom (Fig. 2). Scientists of the Biochemical Insects Adaptation Laboratory in the Ufa Scientific Centre of the Russian Academy of Science have been monitoring the gene pool of the Burzyan honeybees for the last 20 years using the polymorphism of loci COI-COII of mtDNA and microsatellite loci ap243 and 4a l 1 0 of nuclear DNA. This extensive research confirmed the pureness of the gene pool and that this gene pool is of the subspecies A. m. mellifera. In 2011, at the request of the Institute of Beekeeping and the ShulganTash State Reserve, bees from this population were classified as a sepa rate breed: the «Burzyan wild-hive bee». This breed was registered under patent No.5956 in 14.06.2011 by the State Commission of the Russian Federation in the state register. According to artefacts found at the burial site of the Bahmutin culture near Birsk, beekeeping in the southern Urals started no later than the 5th-6th centuries ВС among local Finno-Ugric tribes. Later, beekeeping was adopted by ancestors of the Bashkirs, who assimilated or drove away the Bahmutin people. Beekeeping could be practised without iron tools and the skills accumulated were passed on by many generations of tree-cavity beekeepers (Fig. 3). Bashkir beekeeping flourished in the 18th century, it took longer to develop than in Germany, Poland, Lithuania, Belarus and central regions of Russia, but they had a more perfect, convenient and reliable set of tools and accessories. With special land tenure rights, the Bashkirs could avoid compliance with the requirements of the Forest Service in Russia, which in 1 882 had banned beekeeping in state forests as a source of forest fires. In 1 9th century due to deforestatio and the destruction of the cultural traditions by the migrant population Bashkir beekeepers developed «koloda» beekeeping. A «koloda» is man-made cavity within a section of tree trunk (Fig. 3b), which could be fixed high on a tree. Trees with kolodas were considered by Bashkir as personal property and were marked with tamga» - a distinctive sign of tribal affiliation (Fig. 4). Every beekeeper knew his mark and did not touch the property of others, and these trees with kolodas and tamgas were traditionally kept by a family for generations. In the second half of the 20th century Bashkir beekeepers started using movable-frame hives, which gave rise to modern beekeeping. Despite its hard labour and low productivity, tree-cavity apiculture in remote areas of the South Urals still continues. Inspections of hollow tree hive bees require work as high as 1 6 metres, and because they are located away from populated areas, the beekeeper has to travel on horseback a distance of 40-50 km per day (Fig. 5). The tools used by Bashkir beekeepers are mostly homemade but are similar to tools used in other countries. Tools unique to the Bashkir wild-hive beekeepers are the «kiram» and the «lange». A «kiram» is a braided leather belt up to five metres in length for climbing up a tree. A «lange» is a smal l portable platform or footrest (Fig. 5c), which is fixed on the trunk with a rope. In previous centuries, when there were enough natural cavities in the trees with bees, Bashkirs, like beekeepers around the world, took all the honey from the colony in the autumn, and the bees were left without reserves and died. In spring, beekeepers would check these tree cavities, clean them and make them ready for a new occupants in the form of swarms. This «colonykilling» system was used until the 1 9th century and in some areas until the 1950's. The advantages of this system were that a new comb was created every year, the tree cavities rotted less and, as a result, bees were rarely sick, their body size did not decrease, and there was no inbreeding or degeneration. When the number of natural tree cavities declined sharply, beekeepers were forced to carefully treat the wild-hive bees more carefully and for the best colonies, to leave a sufficient amount of honey for the winter. As a result, colonies were able to live a long time in the same place - up to 1 8-25 years! Also, the beekeepers had to learn how to replace a comb and the life of the cavities was reduced. Wild-hive bees in the Ural area also have many natural enemies that weaken the colony and cause their death. These are: brown bears Ursus arctos, pine martens Martes martes, forest mice Apodemus uralensis, great spotted woodpeckers Dendrocopos major, european bee-eaters Merops apiaster, greater wax moths Calleria mellonella, european hornets Vespa crabro, red wood ants Formica rufa, and red wasps Dolichovespula rufa. They also have not avoided modern honey bee diseases and parasites, such as varroa mites Varroa destructor, nosema Nosema apis, chalkbrood disease Ascosphaerosis, American foulbrood Paenibacillus larvae, and European foulbrood Melissococcus pluton. These are however more severe in modern, movable-frame hives than in treecavity hives. The population of treecavity bees has cyclical swings dependent on solar activity. Currently, dark European bees exist in the southern Urals in the ShulganTash State Reserve where they live in natural and man-made tree cavities. The Reserve was established in 1 958 and it covers an area of about 54.000 acres. The bees also live in the regional Altyn Solok Nature Reserve (an area of 222.000 acres, established in 1997), and the Bashkiria National Park (an area of 203.000 acres, formed in 1986). At the end of 2014, these three national parks had about 1.200 trees with «koloda» handmade tree-cavity hives, but only 300 of them had bees. About 4.000 colonies were kept in apiaries with modern movable-frame hives and 200-400' colonies lived in natural tree cavities. In 201 2, these Reserves were listed as especially protected areas, together with a number of others, and acquired the status of a biosphere by UNESCO called the «Bashkir Ural» complex with a total area of 855 thousand acres. The regional Altyn Solok Reserve is also protected by the Ministry of Environment of the Republic of Bashkortostan. Currently, in order to preserve the Burzyan honey bee, it is planned to expand the Shulgan-Tash Reserve in a north-westerly direction through undeveloped territory between the rivers Nugush and Uruk. The staff from Shulgan-Tash, Altyn Solok and the Bashkiria National Park, together with local beekeepers, are constantly taking measures to increase the bee population and carry on selection work to improve the immunity, winter hardiness and productivity of the Burzyan bees. This policy of state-protected reservations allows us to save a unique population of these A. m. mellifera bees in Eurasia in the face of new threats of spontaneous hybridization and habitat destruction.
 200. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Новый подход к селекции семей темной лесной пчелы A. m. mellifera по генетическим характеристикам // Биомика. 2016. Т.8. №3. С. 208-214 (Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. New approach to the selection of the dark forest bee colonies A. m. mellifera on genetic characteristics (translation). Biomics. 2016. V. 8. No. 3. P. 208-214.).
Новый подход к селекции семей темной лесной пчелы A. m. mellifera по генетическим характеристикам (New approach to the selection of the dark forest bee colonies A. m. mellifera on genetic characteristics) Ильясов Р.А., Поскряков А.В., Николенко А.Г. Новый подход к селекции семей темной лесной пчелы A. m. mellifera по генетическим характеристикам // Биомика. 2016. Т.8. №3. С. 208-214 (Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. New approach to the selection of the dark forest bee colonies A. m. mellifera on genetic characteristics (translation). Biomics. 2016. V. 8. No. 3. P. 208-214.). Аннотация. В статье нами представлен молекулярно-генетический анализ популяций и семей темной лесной пчелы A. m. mellifera Урала и Поволжья в сравнении с популяциями пчел «южных» подвидов A. m. caucasica и A. m. carpatica Кавказа и Карпат на основе полиморфизма 9 микросателлитных локусов яДHK. Нами получены генетические характеристики для популяции (Ho=0,24, Hs=0,23, Ht=0,28, Fis=0,06, Fit=0,14, Fst=0,17) и семьи (Ho=0,20, Hs=0,16, Ht=0,15, Fis=0,23, Fit=0,35, Fst=0,11) темной лесной пчелы A. m. mellifera и предложена методика селекции семей темной лесной пчелы с интрогрессией “южных” генов не более 5%, и генетическими показателями, характерными для чистопородных семей A. m. mellifera (Ho ≤ 0,30, Hs ≤ 0,30, Ht ≤ 0,30, Fis ≤ │0,45│, Fit ≤ │0,55│, Fst ≥ │0,11│). Abstract. In this article we have carried out a molecular genetic analysis of the populations and colonies of the dark forest bee A. m. mellifera from the Urals and the Volga region in comparison with populations of the bees of “southern” subspecies A. m. caucasica and A. m. carpatica from the Caucasus and the Carpathians based on the polymorphism 9 microsatellite loci of the nuclear DNA. We was proposed in this article the genetic characteristics of the population (Ho=0,24, Hs=0,23, Ht=0,28, Fis=0,06, Fit=0,14, Fst=0,17) and the colony (Ho=0,20, Hs=0,16, Ht=0,15, Fis=0,23, Fit=0,35, Fst=0,11) of the dark forest bee A. m. mellifera were calculated and the method of selection of the dark forest bee colonies with introgression of "southern" less than 5% and genetic characteristic of thoroughbred colonies A. m. mellifera (Ho ≤ 0,30, Hs ≤ 0,30, Ht ≤ 0,30, Fis ≤ │0,45│, Fit ≤ │0,55│, Fst ≥ │0,11│).
 199. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Анализ генофонда бурзянской популяции темной лесной пчелы A.m.mellifera L. // Биомика. 2016. Т.8. № 3. С. 200-207. (Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Analysis of the gene pool of the burzyan population of dark forest bee A. m. mellifera (translation). Biomics. 2016. V. 8. No. 3. P. 200-207.)
Анализ генофонда бурзянской популяции темной лесной пчелы A.m.mellifera L. (Analysis of the gene pool of the Burzyan population of dark forest bee A. m. mellifera L.) Ильясов Р.А., Поскряков А.В., Николенко А.Г. Анализ генофонда бурзянской популяции темной лесной пчелы A.m.mellifera L. // Биомика. 2016. Т.8. № 3. С. 200-207. (Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Analysis of the gene pool of the burzyan population of dark forest bee A. m. mellifera (translation). Biomics. 2016. V. 8. No. 3. P. 200-207.) Аннотация. Проведен мониторинг генофонда популяции темной лесной пчелы Бурзянского района Республики Башкортостан в период с 2004 по 2015 гг. на основе изучения полиморфизма 9 микросателлитных локусов яДНК. Выполнена оценка уровня интрогрессии «южных» генов по годам и по отдельным выборкам для разных годов исследований. Показана высокая стабильность и чистота генофонда популяции темной лесной пчелы Бурзянского района со средним уровнем интрогрессии «южных» генов 2,7%. Представлена высокая эффективность сохранения чистоты генофонда A. m. mellifera на территории природоохранных организаций - заповедников, национальных парков и заказников. Abstract. Monitoring of the gene pool of the dark forest bee population of the Burzyansky district of the Republic of Bashkortostan was performed from 2004 to 2015 based on the study of a polymorphism of 9 microsatellite loci of the nuclear DNA. The level of «southern» genes introgression for samples by years and for every samples researches in different years was evaluated. The high stability and purity of the gene pool of a dark forest bees population of the Burzyansky district with average level of introgression of «southern» genes 2.7% was shown. The high efficiency of the conservation of the gene pool purity of the A. m. mellifera on the territory of a preserving nature organizations - reserves, national parks and sanctuaries.
  198. Николенко А.Г., Гатауллин А.Р., Каскинова М.Д., Ильясов Р.А. Генетическая структура уральской популяции темной лесной пчелы. Материалы научно-практической конференции «Современное пчеловодство. Проблемы разведения и селекции», посвященной 85-летию Научно-исследовательского института пчеловодства, 90-летию со дня рождения Г.Д.Билаша, 70-летию со дня рождения Н.И.Кривцова. Рыбное: ФГБНУ «НИИ пчеловодства», 18 сентября 2015 г. C. 42-45. (Nikolenko A.G., Gataullin A.R., Kaskinova M.D., Ilyasov R.A. The Genetic structure of the Ural population of the Dark European bees (translated). Proceedings of the international scientific-practical conference "Current beekeeping. Problems of breeding and selection” 18 september 2016. Rybnoe: Institute of Beekeeping. P. 42-45). Генетическая структура уральской популяции темной лесной пчелы (Genetic structure of the Ural population of the Dark European bees)
Николенко А.Г., Гатауллин А.Р., Каскинова М.Д., Ильясов Р.А. Генетическая структура уральской популяции темной лесной пчелы. Материалы научно-практической конференции «Современное пчеловодство. Проблемы разведения и селекции», посвященной 85-летию Научно-исследовательского института пчеловодства, 90-летию со дня рождения Г.Д.Билаша, 70-летию со дня рождения Н.И.Кривцова. Рыбное: ФГБНУ «НИИ пчеловодства», 18 сентября 2015 г. C. 42-45. (Nikolenko A.G., Gataullin A.R., Kaskinova M.D., Ilyasov R.A. The genetic structure of the Ural population of the Dark European bees (translated). Proceedings of the international scientific-practical conference "Current beekeeping. Problems of breeding and selection” 18 september 2015. Rybnoe: Institute of Beekeeping. P. 42-45). Проблема сохранения пород и их биоразнообразия особенно остро ощущается в современном пчеловодстве. В США, после роста потерь пчелиных семей с 15 до 30 % за зимний период в 2005-2008 гг. и последующего короткого затишья, в 2014-2015 гг. было потеряно 40-50 %, причем в 2015 г. потери в 27 % семей пришлись уже на летний период. В России после 30 % потерь за зимовку 2002-2003 гг. официальная статистика до последнего времени не велась. По данным нашего опроса, выполненного в рамках исследований международной научной сети COLOSS, потери пчелиных семей в России за зиму 2014/15 г. составили 20 %. Если учесть, что пчелы в России слабо задействованы в интенсивных процессах, аналогичных опылению миндаля в США или круглогодичному опылению теплиц в Японии, эта величина потерь весьма велика. На этом фоне активизируются научные исследования и практические мероприятия по сохранению генофонда подвида темная лесная пчела Apis mellifera mellifera L., обладающего повышенной природной устойчивостью к ряду заболеваний и континентальному климату. В отсутствие существенной государственной поддержки в России основной акцент нашего проекта сделан на выделение сохранившихся локальных популяций этого подвида и создание сети частных племенных пасек для расширенного воспроизводства пчелиных семей и маток. Аналогичный подход реализуется в Германии. В качестве обязательных дополнений разрабатываются четкая внутривидовая систематика, эффективные методы идентификации генофонда и, как программа максимум, изучаются перспективы селекции на миролюбие и другие QTL. Поиск и идентификация локальных популяций происходит на трех уровнях. На первом собираются и, по возможности, географически локализуются все упоминания о популяциях и экотипах темной лесной пчелы на территории России и СНГ, а также работы систематиков, касающиеся подвидов филогенетической линии М, таких как Apis daurica Fischer von Waldheim, 1843; A. m. mellifera natio tesquorum Skorikov, 1929; A. m. acervorum Skorikov, 1929;A. m. silvarum Alpatov, 1935; A. m. taurica Alpatov, 1935 (крымская пчела); A. m. ussuriensis Lawrjochin, 1960 (дальневосточная пчела); A. m. artemisia Engel, 1999 (русская степная пчела); A. m. sossimai Engel, 1999 (украинская пчела) и т.д. В качестве второго слоя информации используются все доступные нам точечные генетические оценки подвидовой принадлежности популяций методами морфометрии, электрофореза изоферментов и ДНК-анализа, а также экспертные оценки размеров популяций и их географической локализации. Помимо идентификации популяций эти данные используются для расчетов генетических расстояний между популяциями и последующего выделения генетических резерватов, построения схем дальнеродственного внутрипородного скрещивания. Хотя при сложившейся ситуации фактически все сохранившиеся генетически чистые (чистопородные) популяции приходится рассматривать как генетические резерваты. В последние годы наблюдается планомерный переход от точечной констатации факта существования популяций к планомерному геногеографическому анализу (Miguel, 2007; Николенко др., 2010). На третьем этапе наших исследований мы проводим детальный геногеографический анализ для определения границ и структуры ареалов, понимания генетических процессов и факторов, определяющих стабильность генофондов, поиска оптимальных консервационных стратегий, формирования изолированных или генетически пригодных мест (точков) для облета (естественного осеменения) маток. Параллельно ведутся исследования для создания сети частных, регулярно сертифицируемых племенных пасек, занимающихся расширенным воспроизводством пчелиных семей и маток. В начале геногеографических исследований нами была проведена оценка информативности ряда микросателлитных локусов. В качестве рабочего набора выбраны локусы Ap243, 4A110, A24, A8, A43, A113, A88, Ap049, и A28. На основе полиморфизма микросателлитных локусов показано, что, во-первых, все выборки из сохранившихся популяций Apis mellifera mellifera имеют характерный и достаточно стабильный спектр частот аллелей исследованных локусов. Во-вторых, этот спектр четко отличается от аналогичных результатов для выборок из популяций Apis mellifera caucasica и Apis mellifera carpatica. На основе полиморфизма микросателлитных локусов и PLOT-анализа разработан метод для количественной оценки степени гибридизации отдельно взятой пчелиной семьи. Общепринятый в мире диагностический метод рестрикционного анализа (ПЦР-ПДРФ) локуса COI-COII мтДНК с использованием DraI (Cornuet et al., 1993) не позволил нам найти какой-либо полиморфизм, что подтверждает гипотезу исходного расселения темной лесной пчелы из Западной Европы после последнего ледникового периода.Предполагаемые рефугии существовали на средиземноморском побережье Франции (с меньшей вероятностью в Испании). Низкий уровень рестрикционного полиморфизма мтДНК в бурзянской популяции показал предпочтительность простого ПЦР анализа, разработанного нами ранее. В ходе анализа нуклеотидной последовательности межгенного локуса COI-COII мтДНК проведен поиск новых митотипов линии М, как потенциальных маркеров для идентификации и дифференциации Apis mellifera mellifera. Выявлены новые, ранее не описанные митотипы класса М, которые встречаются только на территории Урала и могут быть использованы в качестве маркеров. Предварительно определены границы и структура уральской популяционной системы Apis mellifera melliferaпо ядерной и мтДНК. Наиболее детально проведен геногеографический анализ бурзянской и мишкинской популяций. Полученные результаты позволяют нам утверждать, что реальные биологические популяции медоносной пчелы в России существуют. Выделены центральная и периферическая зоны бурзянской популяции. Показана высокая генетическая близость бортевых пчел и пасечных пчелиных семей. Как показали наши исследования, общая численность бурзянской популяции составляет не менее 7 тыс. чистопородных пчелиных семей. Таким образом, это самая крупная из сохранившихся в мире локальных популяций Apis mellifera mellifera. Ареал популяции не совпадает с границами Бурзянского района, а охватывает горнолесные зоны районов, прилегающих к нему, т.е. занимает значительную площадь, протянувшуюся с севера на юг вдоль горных систем Южного Урала. Проведен анализ генетических процессов, протекающих на границе центральной и периферийной зон популяции, а также на границе периферийной зоны популяции и гибридной зоны, выделены основные факторы как определяющие стабильность генофонда, так и представляющие угрозу для него. Особенно интенсивно генетические процессы протекают на стыке периферии популяции и гибридной зоны. В первую очередь, это поток генов, который до определенной степени уравновешивается отбором. Важную роль в стабилизации генофонда популяции играют географическая изоляция и трутневый фон (панмиксия), а также социальные факторы. Вопреки существующей с XIX века парадигме о возможности сохранения генофонда медоносной пчелы исключительно при разведении в форме популяции закрытого типа показана возможность чистопородного сохранения в масштабах локальной популяции без полной изоляции. Этот результат может существенно упростить технологические проблемы, связанные с искусственной изоляцией и последствиями инбридинга. Новый метод статистического анализа данных позволил нам не только получить точную оцифровку степени чистопородности, но и дал несколько побочных, но очень ценных следствий. Одно из главных - объективная интегральная оценка состояния генофонда в пределах любой площади, т.е. возможность выделить не только районы чистопородного разведения (популяции), но и разделить районы с гибридами как минимум на три категории: зона M (периферийная зона популяции), где наличие гибридов не препятствует чистопородному разведению темной лесной пчелы (трутневый фон темной лесной, среднерусской пчелы сохраняется), зона С - гибридизация зашла так далеко, что можно без опасения гибридизации с темной лесной пчелой разводить южные породы, зона G - зона активной гибридизации, где продолжается этот процесс, завозить туда любой чистопородный материал бесперспективно без предварительного наведения там порядка. Полученные результаты свидетельствуют, что любая зона М и С независимо от наличия гибридов пригодна для полноценного облета маток, но только соответствующей породы, т.е. количество потенциальных облетников больше, чем предполагалось. В РБ существуют большие по площади зоны С, т.е. полноценный ареал разведения южных пород, а количество темной лесной пчелы существенно меньше, чем считалось ранее. Размер бурзянской популяции оказался куда меньше, чем нам казалось по результатам предыдущего исследования. Выявление зон М станет приоритетом наших исследований на ближайшее время. В тех районах России, где предполагается наличие чистопородного материала, мы предлагаем провести бесплатный мониторинг породности: по 5 семей с 4 пасек каждого населенного пункта. О возможности бесплатного анализа породности можно сделать запрос в группе https://vk.com/chestnaya_pchela или по e-mail: a-nikolenko@yandex.ru. The results show that any zone of M and C, regardless of the presence of hybrids, is suitable for a full flight of queens, but only for the corresponding breed, i.e. The number of potential perennials is greater than expected. In the Republic of Belarus, there are large areas of area C, i.e. A full range of breeding southern breeds, and the number of dark forest bees is much smaller than previously thought. The size of the Burzyan population turned out to be much smaller than it seemed to us from the results of the previous study. The identification of M zones will be the priority of our studies for the near future. In those regions of Russia where purebred material is expected, we propose to conduct a free monitoring of the breed: 5 families from 4 apiaries of each settlement.
  197. Ильясов Р.А., Поскряков А.В., Шарипов А.Я. Генетический потенциал пчелиных семей бурзянской популяции. Материалы научно-практической конференции «Современное пчеловодство. Проблемы разведения и селекции», посвященной 85-летию Научно-исследовательского института пчеловодства, 90-летию со дня рождения Г.Д.Билаша, 70-летию со дня рождения Н.И.Кривцова. Рыбное: ФГБНУ «НИИ пчеловодства», 18 сентября 2015 г. C. 35-41. (Ilyasov R.A., Poskryakov A.V., Sharipov A.Y. The genetic potential of the bee colonies of the Burzyan population (translated). Proceedings of the international scientific-practical conference "Current beekeeping. Problems of breeding and selection” 18 september 2016. Rybnoe: Institute of Beekeeping. P. 35-41). Генетический потенциал пчелиных семей бурзянской популяции (The genetic potential of the bee colonies of the Burzyan population)
Ильясов Р.А., Поскряков А.В., Шарипов А.Я. Генетический потенциал пчелиных семей бурзянской популяции. Материалы научно-практической конференции «Современное пчеловодство. Проблемы разведения и селекции», посвященной 85-летию Научно-исследовательского института пчеловодства, 90-летию со дня рождения Г.Д.Билаша, 70-летию со дня рождения Н.И.Кривцова. Рыбное: ФГБНУ «НИИ пчеловодства», 18 сентября 2015 г. C. 35-41. (Ilyasov R.A., Poskryakov A.V., Sharipov A.Y. The genetic potential of the bee colonies of the Burzyan population (translated). Proceedings of the international scientific-practical conference "Current beekeeping. Problems of breeding and selection” 18 september 2015. Rybnoe: Institute of Beekeeping. P. 35-41). Сохранившиеся в чистоте популяции среднерусской пчелы (Apis mellifera mellifera L.) приобрели особую значимость как ценный генетический ресурс данной географической расы пчел [7]. Если всего 200 лет тому назад эта пчела обитала на огромной территории Европы – от Британских островов до Урала, то в начале XXI века ее чистые локальные популяции сохранились только в виде небольших островков [2, 12]. Среди этих популяций максимально чистопородной считается бурзянская бортевая пчела, обитающая в заповеднике «Шульган-Таш» (Бурзянский район Республики Башкортостан) [8]. При этом местная пчела уникальна тем, что часть семей обитает в искусственных и естественных дуплах деревьев. В настоящее время для заповедника «Шульган-Таш» стало актуальным проведение селекции местных пчел с учетом генетического потенциала отдельно взятых пчелиных семей. Согласно нашим исследованиям, величинаинтрогрессии южных генов и уровень генетического разнообразия пчелиных семей отражают генетический потенциал отдельно взятой семьи. Актуальность таких генетических исследований продиктована двумя предпосылками: во-первых, в настоящее время в популяции бурзянской пчелы проявляются следы метизации, интрогрессия южных генов в ней достигает 2 % [3]. Причина общеизвестна – в последние годы местная пчела все больше подвергается давлению южных пчел. Если до 1990-х годов ввоз на сопредельную территорию заповедника пчелиных семей иной породной принадлежности не превышал 1 % от численности семей по Бурзянскому району, то в начале XXI века его можно оценить в 2-3 % [6]. Во-вторых, мы считаем, что ульевые пчелы, живущие длительное время относительно изолированно на пасеках под опекой человека, не могут существовать постоянно в неизменном состоянии. У этих пчел в результате искусственного отбора теряется генетическое разнообразие, накапливается негативный генетический груз. По Р.А. Ильясову, для популяции пчел характерен собственный оптимальный уровень генетического разнообразия: его дефицит приводит к потере экологической пластичности и адаптированности к окружающей среде, а избыток – к потере сбалансированности генома [4]. Цель работы заключалась в изучении генетического потенциала пчелиных семей, выражаемого через величиныинтрогрессии южных генов и генетического разнообразия пчел. Материал исследования.Работа проведена в 2015 г. В исследовании использовано 48 рабочих особей от 12 пчелиных семей. Отобранные от каждой пчелиной семьи по 4 живые пчелы фиксировались в 96 % этаноле и хранились до выделения ДНК при –10 0С. Для генетических исследований формированы 4 группы по 3 семьи в каждой (табл. 1): 1 - пчелиные семьи в бортях – условно «бортевые»; 2 - пчелиные семьи в рамочных ульях, у которых пчелиные матки получены от бортевых пчелиных семей, переселенных в рамочные ульи – «пасечно-бортевые»; 3 - пчелиные семьи в рамочных ульях – «пасечные»; 4 - пчелиные семьи в рамочных ульях, переведенные в разряд основных семей из нуклеусов – «нуклеусы». Методика исследований. Выводы сделаны на основе изучения полиморфизма локусов ДНК: митохондриального (COI-COII) и ядерного (9 микросателлитов – ap243, 4a110, A24, A8, A43, A113, A88, Ap049, A28). Генетические исследования проводились лабораторией биохимии адаптивности насекомых Института биохимии и генетики Уфимского научного центра РАН по хоздоговорной теме (договор № 101 от 01.06.15). Методика определения величины интрогрессии южных генов.Величина интрогрессии южных генов определена по митохондральному геному и ядерному геному ДНК. По митохондральному геному методика основана на четких различиях вариантов локуса COI-COII у представителей эволюционных ветвей М (темная лесная пчела) и С (южные пчелы) [5] (рис. 1). Установлено, что варианты межгенного локуса COI-COII мтДНК PQ, PQQ, PQQQ и PQQQQ встречаются только у темной лесной пчелы, вариант Q – только у южных пчел [11]. Присутствие варианта Q указывает об интрогрессии южных генов. Уровень интрогрессии южных генов рассчитан на основе данных по полиморфизму 9 микросателлитных локусов ядерного генома ap243, 4a110, A24, A8, A43, A113, A88, Ap049, A28 с использованием программы STRUCTURE 2.3.4 [14]. Рис. 1. Локализация межгенного локуса COI-COII мтДНК на кольцевой митохондриальной ДНК медоносной пчелы A. m. mellifera и особенности ее внутривидового полиморфизма(* - гены транспортной РНК) Методика оценки генетического разнообразия пчел.По Р.А.Ильясову [4], основу генетического разнообразия пчел составляет гетерозиготность, поэтому оценка величины средней гетерозиготности по локусам ядерной ДНК будет характеризовать уровень генетического разнообразия отдельно взятой пчелиной семьи. В наших исследованиях средняя гетерозиготность пчелиной семьи рассчитана на основе полиморфизма 9 микросателлитных локусов ядерной ДНК. Основанием такого утверждения является полиандрия – во время брачного полета неплодная матка спаривается не с одним, а с 8-10 и более неродственными трутнями [1]. Это вносит генетическое разнообразие в популяцию рабочих особей пчелиной семьи, то есть в одной семье одновременно присутствует потомство (пчелы) от разных трутней. Данное явление проявляется в виде значительного генетического разнообразия среди рабочих особей семьи. Обсуждение результатов. Как видно из табл. 1, все рабочие особи пчелиных семей являются носителями варианта PQQ локуса COI-COII – это указывает на их происхождение по материнской линии от маток темной лесной пчелы. Присутствие варианта Q локуса являлось бы показателем южного происхождения семей по материнской линии от южных подвидов A.m.caucasica, A.m.carnica, A.m.carpatica, A.m.ligustica [6]. Хотя по митохондриальному геному по полиморфизму локуса COI-COII отобранные семьи пчел охарактеризованы как 100 %-ные темные лесные пчелы, по ядерному геному по полиморфизму 9 микросателлитных локусов нет такого однозначного 100 %-ного результата. Ядерный геном ДНК показал уровень интрогрессии южных генов в отобранных пчелиных семьях от 0,5 до 2,0 % (Куш-Елга-Баш 25-0,5 %, Куш-Елга-Баш 29-1,0 %, Капова Пещера 15-1,0 %, Капова Пещера 31-1,0 %, Байсалян 14-0,5 %). Важно отметить, что южные гены выявлены только в пчелиных семьях, живущих в условиях пасечного пчеловодства, а в пчелиных семьях, живущих в условиях бортевого пчеловодства, а также в нуклеусах, вывезенных в лес, нет (исключение составляет Байсалян 14, у которой содержание южных генов составляет 0,5 %.) Факт наличия следов интрогрессии в пасечных пчелах говорит о том, что давлению южных пчел, в первую очередь, подвержены пчелиные семьи, содержащихся в рамочных ульях. С целью оценки генетических взаимоотношений пчелиных семей рассчитаны генетические дистанции М. Nei (1978) между пчелиными семьями на основе данных полиморфизма 9 микросателлитных локусов. По значениям генетических дистанций построена дендрограмма методом кластеризации ближайшего соседа (Neighbourjoining) (NJ) (рис. 2). Рис. 2. Дендрограмма генетических взаимоотношений пчелиных семей, построенная методом ближайшего соседа по генетическим расстояниям М. Nei (1978) по результатам анализа полиморфизма 9 микросателлитных локусов ap243, 4a110, A24, A8, A43, A113, A88, Ap049, A28. Как видно из рис. 2, внутри кластера в первую подгруппу объединились все чистопородные пчелиные семьи – бортевые пчелиные семьи, Байсалян 1 и Байсалян 13 (эти нуклеусы сформированы под влиянием потока генов бортевых трутней), Куш-Елга-Баш 7. Во вторую (Куш-Елга-Баш 25, Куш-Елга-Баш 29, Капова Пещера 24 и Байсалян 14) и третью (Капова Пещера 15, Капова Пещера 31) подгруппы вошли пчелиные семьи, где содержание южных генов соответственно доходило до 1 и 2 %. Считаем, что такая кластеризация пчелиных семей сформирована под влиянием наличия следов интрогрессии южных генов – в подгруппах наблюдается сближение семей со сходными уровнями интрогрессии. При этом кластерный анализ не смог дифференцировать семью Байсалян 14 со следами интрогрессии в 0,5 % от семьи Капова Пещера 24 с отсутствием интрогрессии. Возможно, что величина интрогрессии в 0,5 % столь мала, что практически не оказала влияния на оценку генетической дистанции. По нашим данным, средняя гетерозиготность пчелиных семей варьирует от 0,12 до 0,40 (табл. 1). Для сравнения приводим данные других авторов, которые вели свои исследования на уровне популяций. Так, средняя гетерозиготность в популяциях A.m.iberiensis в Испании составляет 0,43 – 0,47 [9], в популяциях A.m.ligustica в Португалии: 0,22 – 0,29 [10], в популяциях A.m.mellifera в Швейцарии, Норвегии и Франции: 0,37 – 0,58 [15], в популяциях A.m.mellifera в Польше: 0,49 – 0,64 [13], в популяциях A.m.mellifera в Башкортостане: 0,32 – 0,41 [5]. Мы можем отметить, что уровень гетерозиготности семей пчел по сравнению с аналогичными данными в популяциях ниже. В наших исследованиях наибольшей средней гетерозиготностью характеризуются пчелиные семьи Куш-Елга-Баш 7, Куш-Елга-Баш 25 (0,40 и 0,25), Капова Пещера 15, Капова Пещера 31 (0,35 и 0,25), Байсалян 14 (0,30), наименьшей – семьи Байсалян 1 (0,12). Пчелиные семьи, живущие в бортях, имеют среднее значение гетерозиготности от 0,21 до 0,25. Вероятно, что обитание в условиях дикой природы в дуплах деревьев создает благоприятные условия для сохранения пчелиных семей A.m.mellifera с оптимальным генетическим разнообразием. Мы считаем, что средний уровень гетерозиготности от 0,21 до 0,25, при отсутствии интрогрессия южных генов, будет оптимальным значением генетического разнообразия (соответственно и генетического потенциала) пчелиных семей бурзянской популяции. Если взять за основу эти данные, оптимальными для практической селекции являются семьи Капова Пещера 24 и Байсалян 1 (условно - ее средняя гетерозиготность составляет 0,20). Выводы 1. По митохондриальному геному по полиморфизму локуса COI-COII отобранные пчелиные семьи охарактеризованы как чистопородные семьи пчел. 2. По ядерному геному по полиморфизму 9 микросателлитных локусов ap243, 4a110, A24, A8, A43, A113, A88, Ap049, A28 выявлены следы интрогрессии южных генов от 0,5 до 2,0 %, при этом давлению южных пчел, в первую очередь, подвержены пасечные пчелиные семьи. 3.Средняя гетерозиготность отобранных пчелиных семей варьирует от 0,12 до 0,40, бортевые пчелиные семьи имеют гетерозиготность от 0,21 до 0,25, вероятно, что средняя гетерозиготность бортевых пчелиных семей является оптимальным значением генетического разнообразия пчел. 4. Считаем, что средний уровень гетерозиготности от 0,21 до 0,25 (оптимальное значение генетического разнообразия) при отсутствии интрогрессия южных генов будет оптимальным значением генетического потенциала пчелиных семей бурзянской популяции. Conclusions 1. The honeybee colonies have haracterized purebred based on the polymorphysm of COI-COII loci in the Burzyan bees. 2. The introgression of Southern genes calculated 0,21 to 0,25 in the Burzyan bees based on 9 microsatellite loci ap243, 4a110, A24, A8, A43, A113, A88, Ap049, A28. Most introgression detected in apiaries than tree trunk hollow nesting bees population in the Burzyan. 3. The mean of heterozygosity is 0,12 to 0,40 in apiary living bees and 0,21 to 0,25 in tree trunk hollow nesting bees in the Burzyan. These values of heterozygosity are optimal for dark bees. 4. The optimal level of the heterozygosity 0,21 to 0,25 in the absence of the introgression of southern genes will be the best value of the genetic potential of the bee colonies of the Burzyan population.
  196. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Seven genes of mitochondrial genome enabling differentiation of honeybee subspecies Apis mellifera. Russian Journal of Genetics, 2016, V. 52, No. 10, P. 1062–1070. DOI: 10.1134/S1022795416090064.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Семь генов митохондриального генома, позволяющие дифференцировать подвиды медоносной пчелы Apis mellifera. Генетика. 2016. Т. 52. № 10. С. 1176–1184. (IF 0.446). DOI: 10.7868/S001667581609006X. (Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Seven genes of mitochondrial genome enabling differentiation of honeybee subspecies Apis mellifera. Russian Journal of Genetics, 2016, V. 52, No. 10, P. 1062–1070. DOI: 10.1134/S1022795416090064.) On the basis of comparative sequence analysis of 12 honeybee mitochondrial genes, seven genes enabling us to differentiate honeybees subspecies of the A, M, C, O evolutionary lineages were found. Applying comparative sequence analysis of ND2 gene mtDNA as an example on a statistically valid sample size, we showed a high level of differentiating ability of this gene and assumed that each of these seven genes probably can be used for differentiation of the subspecies within four evolutionary lineages. Проведен сравнительный анализ нуклеотидных последовательностей 12 генов митохондриального генома медоносной пчелы, на основании которого удалось выделить семь генов, позволяющих дифференцировать подвиды пчел эволюционных ветвей А, М, С, О. На примере использования сравнительного анализа нуклеотидной последовательности гена ND2 мтДНК на статистически значимом объеме выборки мы показали высокий уровень дифференцирующей способности этого гена и высказали предположение о возможности отдельного использования каждого из семи генов для дифференциации подвидов четырех эволюционных ветвей.
  195. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Семь генов митохондриального генома, позволяющие дифференцировать подвиды медоносной пчелы Apis mellifera. Генетика. 2016. Т. 52. № 10. С. 1176–1184. (IF 0.446). DOI: 10.7868/S001667581609006X.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Семь генов митохондриального генома, позволяющие дифференцировать подвиды медоносной пчелы Apis mellifera. Генетика. 2016. Т. 52. № 10. С. 1176–1184. (IF 0.446). DOI: 10.7868/S001667581609006X. (Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Seven genes of mitochondrial genome enabling differentiation of honeybee subspecies Apis mellifera. Russian Journal of Genetics, 2016, V. 52, No. 10, P. 1062–1070. DOI: 10.1134/S1022795416090064.) On the basis of comparative sequence analysis of 12 honeybee mitochondrial genes, seven genes enabling us to differentiate honeybees subspecies of the A, M, C, O evolutionary lineages were found. Applying comparative sequence analysis of ND2 gene mtDNA as an example on a statistically valid sample size, we showed a high level of differentiating ability of this gene and assumed that each of these seven genes probably can be used for differentiation of the subspecies within four evolutionary lineages. Проведен сравнительный анализ нуклеотидных последовательностей 12 генов митохондриального генома медоносной пчелы, на основании которого удалось выделить семь генов, позволяющих дифференцировать подвиды пчел эволюционных ветвей А, М, С, О. На примере использования сравнительного анализа нуклеотидной последовательности гена ND2 мтДНК на статистически значимом объеме выборки мы показали высокий уровень дифференцирующей способности этого гена и высказали предположение о возможности отдельного использования каждого из семи генов для дифференциации подвидов четырех эволюционных ветвей.
  194. Ilyasov R.A. Features of the honey bee Apis mellifera genome versus fruit fly Drosophila melanogaster. Journal of Investigative Genomics. 2016. V. 3 No. 2. P. 00044 (1-3). DOI: 10.15406/jig.2016.02.00044 (http://medcraveonline.com/JIG/JIG-03-00044.pdf
)
Ilyasov R.A. Features of the honey bee Apis mellifera genome versus fruit fly Drosophila melanogaster. Journal of Investigative Genomics. 2016. V. 3 No. 2. P. 00044 (1-3). DOI: 10.15406/jig.2016.02.00044 (http://medcraveonline.com/JIG/JIG-03-00044.pdf
)
The analysis of the nuclear and the mitochondrial genomes of the honey bee Apis mellifera in comparison with the well-annotated, finished fruit fly Drosophila melanogaster genome was presented in this article. The nuclear genome of the honey bee has about 245 millions b.p. which distributed in 16 chromosomes and contains about 10 thousands genes. The mitochondrial genome of the A. mellifera has about 16 thousands b.p. which located in mitochondrion’s and contains 35 genes. The nuclear genome of the fruit fly has about 144 millions b.p. which distributed in 4 chromosomes and contains about 17 thousands genes. The mitochondrial genome of the D. melanogaster has about 19 thousands b.p., which located in mitochondrion’s and contains 37 genes. Despite the full sequencing of the nuclear and the mitochondrial genomes of the A. mellifera the function of several genes and loci of A. mellifera are not disclosed fully. A comparative analysis of the genomes of A. mellifera and D. melanogaster using bioinformatics techniques allowed to reveal the features of the structure and function of the honey bee A. mellifera genome. The genome of A. mellifera have more similarity with the vertebrate genome than D. melanogaster. The genome of A. mellifera contains less genes of the native immunity, of detoxification enzymes, of cuticle proteins and taste receptors compared with D. melanogaster. However, A. mellifera contains new genes associated with olfactory receptors, the processing of pollen and nectar, poison organs, wax glands, caste determination and labor division which absent at D. melanogaster. Probably, this is due to the ecology of bees and their social evolution.
  194. Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Глава 5.13. Пять сохранившихся резерватов темной лесной пчелы Apis mellifera mellifera Урала и Поволжья. В книге: Темная лесная пчела Apis mellifera mellifera L. Республики Башкортостан / Ред. Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина. Москва: Товарищество научных изданий КМК, 2016. С. 278-289. ISBN 978-5-9908416-0-4. 320 с., 20 вкл. (Ilyasov A. Rustem, Poskryakov V. Alexandr, Petukhov V. Alexandr, Nikolenko G. Alexei. Chapter 5.13. Five remaining reserves of the dark forest bees Apis mellifera mellifera in the Urals and the Volga region. In: Ilyasov R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis mellifera mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov, A.G. Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press, 2016. P. 278-289. ISBN 978-5-9908416-0-4. 320 p., 20 color inserts.)
Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Глава 5.13. Пять сохранившихся резерватов темной лесной пчелы Apis mellifera mellifera Урала и Поволжья. В книге: Темная лесная пчела Apis mellifera mellifera L. Республики Башкортостан / Ред. Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина. Москва: Товарищество научных изданий КМК, 2016. С. 278-289. ISBN 978-5-9908416-0-4. 320 с., 20 вкл. (Ilyasov A. Rustem, Poskryakov V. Alexandr, Petukhov V. Alexandr, Nikolenko G. Alexei. Chapter 5.13. Five remaining reserves of the dark forest bees Apis mellifera mellifera in the Urals and the Volga region. In: Ilyasov R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis mellifera mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov, A.G. Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press, 2016. P. 278-289. ISBN 978-5-9908416-0-4. 320 p., 20 color inserts.) Для локальных популяций пчел Урала, Поволжья были рассчитаны доли генов южных подвидов по ядерному и митохондриальному геномам (табл. 4). Гистограмма (plot), построенная по данным полиморфизма микросателлитных локусов, наглядно показывает сохранение ядерного генома темной лесной пчелы A. m.mellifera в локальных популяциях Урала и Поволжья (рис. 1). Минимальным уровнем интрогрессии южных генов по ядерному геному характеризовались локальные популяции темной лесной пчелы Республики Башкортостан (бурзянская, татышлинская, янаульская, балтачевская, караидельская, мишкинская, кушнаренковская), Пермского края (ординская, осинская, частинская, добрянская, красновишерская, юсьвенская, нытвенская, усольская, уинская, пермская), Республики Удмуртия (камбарская, можгинская, якшур-бодьинская, малопургинская), Республики Татарстан (мамадышская), Республики Чувашия (чебоксарская), Кировской области (кильмезская). На основе попарных значений Fst между локальными популяциями темной лесной пчелы A. m. mellifera Урала и Поволжья, полученных по результатам анализа полиморфизма микросателлитных локусов, была построена дендрограмма методом кластеризации ближайшего соседа, которая подтверждает данные уровня интрогрессии по ядерному геному. Локальные популяции пчел южных подвидов A. m. caucasica и A. m. carpatica Кавказа и Карпат были использованы для сравнения в качестве внешней группы (рис. 2). На дендрограмме локальные популяции южных пчел Кавказа и Карпат четко дифференцируются и располагаются отдельно (группа I). Локальные популяции местных пчел Урала и Поволжья подразделяются на две группы II и III. В группе III преобладают локальные популяции пчел Республики Башкортостан, имеющие значительный уровень интрогрессии генов южных подвидов эволюционной ветви С. Во группе II локальные популяции пчел Урала и Поволжья подразделяются на две подгруппы II-1 и II-2. В подгруппе II-1 представлены примерно поровну локальные популяции пчел Урала и Поволжья, имеющие незначительный уровень интрогрессии генов южных подвидов. В подгруппе II-2 преобладают локальные популяции темной лесной пчелы Урала, характеризующиеся минимальным уровнем интрогрессии генов южных подвидов. Для проведения геногеографического анализа секторные диаграммы, отражающие доли интрогрессии генов южных подвидов пчел эволюционной ветви С в локальных популяциях темной лесной пчелы Урала и Поволжья эволюционной ветви М, были расположены по местам их локализации на географической карте (рис. 3). На территории Урала и Поволжья гены темной лесной пчелы A. m. mellifera сохранились не равномерно - наблюдается тенденция возрастания доли генов эволюционной ветви М по ядерному и митохондриальному геномам с юга на север. В южной части Урала и Поволжья наблюдается единственная сохранившаяся в чистоте локальная популяция темной лесной пчелы - бурзянская, которая находится под охраной заказника «Алтын Солок», заповедника «Шульган-Таш» и национального парка «Башкирия». Исходя из пространственного распределения локальных популяций, характеризующихся минимальной интрогрессией генов южных подвидов по ядерному и митохондриальному геномам, нам удалось выделить на территории Урала и Поволжья пять сохранившихся популяций (резерватов) темной лесной пчелы A. m. mellifera: бурзянская, татышлинская, южно-прикамская, вишерская и камбарская. Эти популяции на данный момент характеризуются достаточной численностью, стабильной и сбалансированной генетической и генотипической структурой и небольшим отклонением в распределении частот генотипов от равновесного распределения по Харди-Вайнбергу. Эти пять популяций составляют основу современного генофонда темной лесной пчелы A. m. mellifera Урала и Поволжья. Для успешного сохранения выделенных нами пяти популяций темной лесной пчелы на территории Урала и Поволжья необходимо проводить постоянный мониторинг и управлять их генофондом в соответствии с принципами популяционной генетики. For local populations of bees of the Urals, the Volga region were calculated share of the southern subspecies of the genes on the nuclear and mitochondrial genomes (Table. 4). Histogram (the plot), built according to the polymorphism of microsatellite loci, clearly shows the retention of the nuclear genome of a dark forest bees A. m.mellifera in local populations of the Urals and the Volga region (Fig. 1). The minimum level of introgression southern genes nuclear genome characterized local populations dark forest bee Republic of Bashkortostan (Burzyan, tatyshlinskaya, YANAULSKY, baltachevskaya, karaidelskaya, Mishkinskoye, Kushnarenkovsky), Perm Territory (Orda, Osinskaya, chastinskaya Dobriansky, Krasnovishersk, yusvenskaya, Nytvensky, Usolye , Uinskoye, Perm), Republic of Udmurtia (Kambarka, Mozhginsky, Yakshur-Bodyinsky, Malopurginskiy), the Republic of Tatarstan (Mamadysh), Republic of Chuvashia (Cheboksary), the Kirov region (kilmezskaya). On the basis of pairwise Fst values between the local populations of the dark forest bees A. m. mellifera Urals and the Volga region, obtained from the analysis of polymorphism of microsatellite loci was constructed by clustering dendrogram nearest neighbor, which confirms data introgression level nuclear genome. Local bee population of the southern subspecies A. m. caucasica and A. m. carpatica Caucasus and the Carpathians were used for comparison as an external group (Fig. 2). In the dendrogram local populations of the southern Caucasus and Carpathian bees clearly differentiated and are located separately (group I). Local populations of native bees Urals and the Volga region are divided into two groups II and III. In Group III is dominated by the local bee population of the Republic of Bashkortostan, having a significant level of introgression of genes southern subspecies evolutionary branch C. In Group II, the local bee population of the Urals and the Volga region are divided into two subgroups II-1 and II-2. In the subgroup II-1 represented about equally local bee population of the Urals and the Volga region, having a low level of introgression of genes southern subspecies. In the subgroup II-2 is dominated by local populations dark forest bees Urals, characterized by a minimum level of introgression of genes of the southern subspecies. For the genogeographical analysis pie charts, reflecting the proportion of introgression of genes of the southern subspecies of bees evolutionary branches with local populations in the dark forest bees Urals and Volga evolutionary branches of M, were located in places of their location on a map (Fig. 3). On the territory of the Urals and the Volga region genes dark forest bees A. m. mellifera not uniformly preserved - there is a tendency of increasing the proportion of genes evolutionary branches of M on nuclear and mitochondrial genomes from south to north. In the southern part of the Urals and the Volga region there is only surviving local population clean dark forest bee - Burzyan, which is under the protection of the reserve "Altyn Solok" reserve "Shulgan-Tash" and the national "Bashkiria" park. Based on the spatial distribution of local populations, introgression of genes characterized by a minimum of southern subspecies of nuclear and mitochondrial genome, we were able to identify in the Urals and the Volga region five surviving populations (reserves) dark forest bees A. m. mellifera: Burzyan, tatyshlinskaya, South Prikamskaya, Visherskaya and Kambarka. This population is currently characterized by a sufficient number of stable and balanced genetic and genotypic structure and a small deviation in the distribution of genotype frequencies from the equilibrium distribution of Hardy-Weinberg. These five populations are the basis of modern gene pool of dark forest bees A. m. mellifera Urals and the Volga region. To successfully save us five isolated populations of a dark forest bees in the Urals and the Volga region it is necessary to continuously monitor and control their gene pool in accordance with the principles of population genetics.
  193. Ильясов Р.А., Поскряков А.В., Салтыкова Е.С., Николенко А.Г. Глава 5.12. Диагностика темной лесной пчелы башкирской популяции на основе полиморфизма гена вителлогенина VG. В книге: Темная лесная пчела Apis mellifera mellifera L. Республики Башкортостан / Ред. Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина. Москва: Товарищество научных изданий КМК, 2016. С. 271-278. ISBN 978-5-9908416-0-4. 320 с., 20 вкл. (Ilyasov A. Rustem, Poskryakov V. Alexandr, Saltykova S. Elena, Nikolenko G. Alexei. Chapter 5.12. Identification of dark forest bees of the Bashkir population, based on vitellogenin gene (VG) polymorphism. In: Ilyasov R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis mellifera mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov, A.G. Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press, 2016. P. 271-278. ISBN 978-5-9908416-0-4. 320 p., 20 color inserts.)
Ильясов Р.А., Поскряков А.В., Салтыкова Е.С., Николенко А.Г. Глава 5.12. Диагностика темной лесной пчелы башкирской популяции на основе полиморфизма гена вителлогенина VG. В книге: Темная лесная пчела Apis mellifera mellifera L. Республики Башкортостан / Ред. Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина. Москва: Товарищество научных изданий КМК, 2016. С. 271-278. ISBN 978-5-9908416-0-4. 320 с., 20 вкл. (Ilyasov A. Rustem, Poskryakov V. Alexandr, Saltykova S. Elena, Nikolenko G. Alexei. Chapter 5.12. Identification of dark forest bees of the Bashkir population, based on vitellogenin gene (VG) polymorphism. In: Ilyasov R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis mellifera mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov, A.G. Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press, 2016. P. 271-278. ISBN 978-5-9908416-0-4. 320 p., 20 color inserts.) Для исследования были отобраны 12 рабочих пчел из разных пчелиных семей с пасек, расположенных в ареалах генетических изолятов подвида A.m.mellifera: д. Кагарманово, с. Кага и с. Серменево Белорецкого района, д. Галиакберово, д. Яумбаево и д. Иргизлы Бурзянского района, д. Кустаревка, д. Сабанчи и д. Уядыбаш Татышлинского района Республики Башкортостан (Республики Башкортостан), д. Нытва Нытвенского района и двух пасек в д. Поршакова Красновишерского района и с. Юсьва Юсьвинского района Пермского края (ПК). Пчелы проверялись на принадлежность к подвиду A.m.mellifera по структуре межгенного локуса COI-COII мтДНК и спектрам аллелей 9 микросателлитных локусов: Ap243, 4a110, A24, A8, A43, A113, A88, Ap049 и A28 (Никоноров и др., 1998; Николенко, Поскряков, 2002; Ильясов и др., 2007). Обсуждениe. При сравнении просеквенированных нами нуклеотидных последовательностей гена Vg пчел из Уральского региона с последовательностями этого гена для пчел линии С, представленной в GenBank, было обнаружено 26 SNP, которые четко дифференцировали представителей двух эволюционных ветвей - М и С (табл. 3). Эти SNP могут быть использованы в качестве генетических ядерных маркеров для поиска сохранившихся изолятов A.m.mellifera в России в условиях гибридизации с пчелиными семьями с Кавказа и из стран Средней Азии и Восточной Европы. Сравнительный анализ нуклеотидных последовательностей гена Vg пчел эволюционных ветвей M и C (GenBank и наши данные) показал, что во 2-м экзоне встречались три дифференцирующие эти линии позиции SNP, в 3-м экзоне - 5, в 4-м экзоне - 5, в 5-м экзоне - 7, в 6-м экзоне - 6, в 7-м экзоне - не встречались. Таким образом, по результатам анализа гена Vg пчел эволюционных ветвей M и C были максимально информативны 5-й и 6-й экзоны, среднеинформативны 2-й, 3-й и 4-й экзоны, и неинформативен 7-й экзон. На основе кластерного анализа в программе MEGA 4.1. методом объединения ближайших соседей просеквенированных нами нуклеотидных последовательностей гена Vg пчел из уральского региона и нуклеотидных последовательностей пчел эволюционной ветви М (изоляты I2331, I2332, I2341, I2342, I2481, I2482, I2561, I2562 из Испании и M2271 M2272 из Польши), эволюционной ветви A (изоляты S2851, S2852, S2901, S2902, S2981, S2982, S2991, S2992, S3001, S3002 из Южной Африки) и эволюционной ветви С (изоляты C1811, C1812 из Германии, C2001, C2002 из Хорватии, C2731, C2732 из Словении, L2321, L2322 из Египта) из GenBank (Kent et al., 2011) была построена дендрограмма, наглядно отображающая генетические взаимоотношения пчел разных эволюционных ветвей (рис. 2). Все привлеченные к анализу нуклеотидные последовательности гена Vg четко кластеризовались в три группы, соответствующие трем эволюционным ветвям пчел: А (Африка), М (Урал и Западная Европа) и С (Ближний Восток и страны Восточной Европы). Пчелы из Уральского региона кластеризовались в одну группу с представителями западноевропейских популяций эволюционной ветви М, что подтверждает их генетическую близость. Пчелы двух изолятов из Южной Африки оказывались близки к группе пчел эволюционной ветви С, что, возможно, связано с ошибочным отнесением авторами по нуклеотидной последовательности гена Vg этих гибридных пчел к эволюционной ветви А (Kent et al., 2011). Таким образом, сравнительный анализ нуклеотидной последовательности гена Vg может быть полезен в филогенетических реконструкциях представителей вида A.mellifera, а обнаруженные 26 позиций SNP могут использоваться в качестве генетических маркеров, дифференцирующих пчел эволюционных ветвей М и С, в селекции чистых линий A.m.mellifera, в проведении генетического штрихкодирования и создании генетического паспорта семей. For the study were selected 12 worker bees from different bee colonies from apiaries located in the resorts of genetic isolates subspecies A.m.mellifera: d Kagarmanova with.. And Kaga. Sermenevo Beloretsk district, Galiakberova D., D. and D. Yaumbaevo Irgizly Burzyansky area Kustarevka D., D. and D. Sabanci Uyadybash Tatyshlinsky District of the Republic of Bashkortostan (RB), D. Nytva Nytvensky district and two apiaries in D. Porshakova Krasnovishersky district and. Yusva Yusvinsky District of Perm Krai (PC). Bees were tested belonging to a subspecies Ammellifera structure intergenic locus COI-COII mtDNA alleles spectra and 9 microsatellite loci: Ap243, 4a110, A24, A8, A43, A113, A88, Ap049 and A28 (Nikonorov et al, 1998; Nikolenko. Poskryakov, 2002; Ilyasov et al, 2007).. Discussion. When comparing the sequenced contact Vg gene nucleotide sequences of the bees from the Ural region with the sequences of the gene for the bees line C provided in the GenBank, 26 SNP was found that clearly differentiated the representatives of the two evolutionary branches - M and C (Table 3.). These SNP may be used as genetic markers for nuclear research surviving isolates A.m.mellifera in Russia in terms of hybridization with bee families from the Caucasus and Central Asia and Eastern Europe. Comparative analysis of nucleotide Vg gene sequences bees evolutionary branch M and C (GenBank and our data) showed that in the 2nd exon met three differentiating these lines SNP positions in the 3rd exon - 5 in the 4th exon - 5 the 5th exon - 7, in exon 6 - 6 in the 7th exon - met. Thus, the results of gene analysis bees Vg M and C evolutionary branches were maximally informative 5th and 6th exons sredneinformativny 2nd, 3rd and 4th exons and neinformativen 7th exon. On the basis of cluster analysis in the program MEGA 4.1. by combining immediate neighbors sequenced us nucleotide Vg gene sequences bees from the Ural region and the nucleotide sequences of bees evolutionary branches of M (isolates I2331, I2332, I2341, I2342, I2481, I2482, I2561, I2562 from Spain and M2271 M2272 from Poland), the evolutionary branch A (isolates S2851, S2852, S2901, S2902, S2981, S2982, S2991, S2992, S3001, S3002 from South Africa) and the evolutionary branch C (isolates C1811, C1812 from Germany, C2001, C2002 from Croatia, C2731, C2732 from Slovenia, L2321 , L2322 from Egypt) from GenBank (Kent et al., 2011) was constructed dendrogram clearly showing genetic relationships bee different evolutionary branches (Fig. 2). All involved in the analysis of the nucleotide sequence of Vg gene clearly clustered into three groups corresponding to three evolutionary branches Bee: A (Africa), M (the Urals and Western Europe) and C (the Middle East and Eastern Europe). Bees from the Ural region clustered in the same group with representatives of Western European populations evolutionary branches M, which confirms their genetic proximity. Bees two isolates from South Africa is close to a group of bees evolutionary branch With that, perhaps due to the erroneous attribution sponsored by the nucleotide sequence of the gene Vg these hybrid bees to the evolutionary branch A (Kent et al., 2011). Thus, the comparative analysis of the nucleotide sequence of Vg gene may be useful in phylogenetic reconstructions of a species A.mellifera, and the detected positions SNP 26 can be used as genetic markers of differentiating bees evolutionary branch M and C, in the selection Ammellifera clean lines to conduct genetic barcoding and the creation of a genetic family passport.
  192. Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Глава 5.11. Генетическая дифференциация уральской популяции темной лесной пчелы. В книге: Темная лесная пчела Apis mellifera mellifera L. Республики Башкортостан / Ред. Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина. Москва: Товарищество научных изданий КМК, 2016. С. 263-270. ISBN 978-5-9908416-0-4. 320 с., 20 вкл. (Ilyasov A. Rustem, Poskryakov V. Alexandr, Petukhov V. Alexandr, Nikolenko G. Alexei. Chapter 5.11. Genetic differentiation of the Ural population of the dark forest bees. In: Ilyasov R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis mellifera mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov, A.G. Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press, 2016. P. 263-270. ISBN 978-5-9908416-0-4. 320 p., 20 color inserts.)
Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Глава 5.11. Генетическая дифференциация уральской популяции темной лесной пчелы. В книге: Темная лесная пчела Apis mellifera mellifera L. Республики Башкортостан / Ред. Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина. Москва: Товарищество научных изданий КМК, 2016. С. 263-270. ISBN 978-5-9908416-0-4. 320 с., 20 вкл. (Ilyasov A. Rustem, Poskryakov V. Alexandr, Petukhov V. Alexandr, Nikolenko G. Alexei. Chapter 5.11. Genetic differentiation of the Ural population of the dark forest bees. In: Ilyasov R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis mellifera mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov, A.G. Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press, 2016. P. 263-270. ISBN 978-5-9908416-0-4. 320 p., 20 color inserts.) Поиск сохранившихся островков популяции темной лесной пчелы A.m.mellifera в Республике Башкортостан и Пермском крае был выполнен на основе полиморфизма длин амплифицированных фрагментов локуса COI-COII мтДНК, где более длинный фрагмент PQQ характеризует местных уральских пчел A.m.mellifera, тогда как более короткий фрагмент Q - характеризует интродуцированные южные подвиды пчел эволюционной ветви С. Частоты вариантов PQQ и Q варьировали в сохранившихся островках популяции темной лесной пчелы A.m.mellifera Республики Башкортостан и Пермского края в пределах от 0.57 до 1.00 (табл. 1). Вишерская, Татышлинская и Бурзянская популяции темной лесной пчелы A.m.mellifera характеризовались очень высокой частотой варианта PQQ - 0.99, а Южно-Прикамская популяция пчел - более низкой частотой 0.90. Высокая частота варианта PQQ (≥ 0.90) позволяет сделать заключение об их принадлежности к подвиду A.m.mellifera по материнской линии. Иглинская популяция медоносной пчелы характеризовалась более низкой частотой варианта PQQ - 0.57, что позволяет предположить о ее гибридизации с интродуцированными южными подвидами пчел эволюционной ветви С. Частоты аллелей двух микросателлитных локусов ap243 и 4a110 распределялись в сохранившихся островках популяции темной лесной пчелы A.m.mellifera неравномерно (табл. 1). В популяции темной лесной пчелы на Урале наиболее часто встречались аллели размером 254 п. н. и 257 п. н. локуса ap243, и аллели размером 160 п. н. и 168 п. н. локуса 4a110. Дендрограмма, визуализирующая генетические взаимоотношения всех островков популяции темной лесной пчелы A.m.mellifera на Урале, была построена в программе STATISTICA 8.0 на основе генетических расстояний D (Nei, 1978) методом группировки ближайших соседей (Saitou, 1987) (рис. 3). На дендрограмме Иглинская популяция располагается отдельно от всех остальных, которые, в свою очередь, группируются вместе. Такое расположение свидетельствует о значительной генетической отдаленности Иглинской популяции от других островков популяции темной лесной пчелы, что, вероятно, является результатом гибридизации местных пчел с интродуцированными южными подвидами эволюционной ветви С. Совместная группировка остальных четырех островков популяции темной лесной пчелы говорит об их генетическом родстве по ядерным локусам. Таким образом, на дендрограмме четко выделяются четыре сохранившихся островка популяции темной лесной пчелы A.m.mellifera: Вишерская, Южно-Прикамская, Татышлинская и Бурзянская. В результате проведенных генетических исследований на основе анализа локусов митохондриальной ДНК (COI-COII мтДНК) и ядерной ДНК (два микросателлитных локуса ap243 и 4a110) популяции темной лесной пчелы A.m.mellifera на територии Урала - Республика Башкортостан (Южный Урал) и Пермский край (Средний Урал) - нами были обнаружены четыре островка сохранившейся популяции темной лесной пчелы: Вишерская, Южно-Прикамская, Татышлинская и Бурзянская. Мы надеемся, что данные, полученные в статье, позволят выполнить новые проекты по поиску новых локализаций сохранившейся популяции темной лесной пчелы A.m.mellifera в России и других странах. В дальнейшем мы планируем расширить число анализируемых локусов и территорию исследований. Search surviving dark forest bee populations Ammellifera islands in the Republic of Bashkortostan and the Perm region was made on the basis of the amplified fragment length polymorphism locus COI-COII mtDNA, where the longer fragment PQQ characterizes the local Ural Ammellifera bees, while a shorter fragment Q - characterizes introduced southern subspecies of bees evolutionary branch C. Frequency options PQQ and Q varied islets surviving population of a dark forest bees A.m.mellifera the Republic of Bashkortostan and the Perm Territory in the range of 0.57 to 1.00 (Table. 1). Visherskaya, Tatyshlinskaya and Burzyan population A.m.mellifera dark forest bees are characterized by very high frequency option PQQ - 0.99, and South Prikamskaya population of bees - a lower incidence of 0.90. High frequency option PQQ (≥ 0.90) allows us to conclude that they belong to the subspecies A.m.mellifera through the maternal line. Iglinskiy honeybee population is characterized by a lower frequency of PQQ version - 0.57, suggesting that its hybridization with introduced southern subspecies of bees evolutionary branch C. The frequencies of alleles of two microsatellite loci ap243 and 4a110 are distributed in the remaining islands population A.m.mellifera dark forest bees unevenly (Table. 1). In the dark forest bee population in the Urals, the most frequent allele size 254 n. N. 257 and n. n. locus ap243, and allele size 160 n. n. 168 and n. n. locus 4a110. Dendrogram visualizing genetic relationship between all the islands dark forest bee populations A.m.mellifera in the Urals, it was built in the program STATISTICA 8.0 based on genetic distances D (Nei, 1978) by grouping the nearest neighbors (Saitou, 1987) (Fig. 3). On dendrogram Iglinskiy population located separately from all the others who, in turn, are grouped together. Such an arrangement shows significant genetic distance from other populations Iglinskiy islets dark forest bee populations, which probably is a result of hybridization with introduced native bees southern subspecies evolutionary branch C. The joint group of the other four islands of dark forest bee population speaks about their genetic relationship on nuclear loci. Thus, in the dendrogram clearly distinguished four remaining island population A.m.mellifera dark forest bees: Visherskaya, South Prikamskaya, Tatyshlinskaya and Burzyan. As a result of genetic research based on analysis of mitochondrial DNA loci (COI-COII mtDNA) and nuclear DNA (microsatellite locus two ap243 and 4a110) population Ammellifera dark forest bee on the territory of the Urals - the Republic of Bashkortostan (South Urals) and the Perm region (the Middle Urals ) - we discovered four island dark forest bees remaining population: Visherskaya, South Prikamskaya, Tatyshlinskaya and Burzyan. We hope that the data obtained in this article will help to fulfill new projects to find new locations remaining population A.m.mellifera dark forest bees in Russia and other countries. In the future we plan to expand the number of analyzed loci and area studies.
  191. Ильясов Р.А., Шареева З.В., Николенко А.Г. Глава 5.10. Генетическая структура северной башкирской популяции темной лесной пчелы. В книге: Темная лесная пчела Apis mellifera mellifera L. Республики Башкортостан / Ред. Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина. Москва: Товарищество научных изданий КМК, 2016. С. 254-263. ISBN 978-5-9908416-0-4. 320 с., 20 вкл. (Ilyasov A. Rustem, Shareeva V. Zita, Nikolenko G. Alexei. Chapter 5.10. Genetic structure of of northern population of native dark forest bees. In: Ilyasov R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis mellifera mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov, A.G. Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press, 2016. P. 254-263. ISBN 978-5-9908416-0-4. 320 p., 20 color inserts.)
Ильясов Р.А., Шареева З.В., Николенко А.Г. Глава 5.10. Генетическая структура северной башкирской популяции темной лесной пчелы. В книге: Темная лесная пчела Apis mellifera mellifera L. Республики Башкортостан / Ред. Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина. Москва: Товарищество научных изданий КМК, 2016. С. 254-263. ISBN 978-5-9908416-0-4. 320 с., 20 вкл. (Ilyasov A. Rustem, Shareeva V. Zita, Nikolenko G. Alexei. Chapter 5.10. Genetic structure of of northern population of native dark forest bees. In: Ilyasov R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis mellifera mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov, A.G. Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press, 2016. P. 254-263. ISBN 978-5-9908416-0-4. 320 p., 20 color inserts.) Целью исследований было изучение структуры популяции медоносной пчелы северного ареала Республики Башкортостан в сравнительном популяционно-генетическом аспекте. По результатам морфометрических исследований в Бирском, Мишкинском и Караидельском районах Республики Башкортостан 79% пасек были отнесены к темной лесной пчеле подвида А.m.mellifera, 21% пасек - к пчелам гибридного происхождения. Данные морфометрических исследований полностью подтверждаются данными, полученными на основе полиморфизма межгенного локуса COI-COII мтДНК и результатам анализа вариабельности микросателлитных локусов ар243, 4а110 и А8 ядерной ДНК. Результаты анализа полиморфизма межгенного локуса COI-COII мтДНК показали, что частота встречаемости комбинации PQQ (табл. 1) у пчел исследуемых районов варьировала от 0.00 (2 пасеки Бирского района - д. Вязовка и д. Старобазаново; 4 пасеки Караидельского района - д. Тайкаш, д. Байки-Юнусова и д. Новый Акбуляк) до 1.00 в абсолютном большинстве изучаемых пасек. Сопоставляя значения частот встречаемости комбинаций межгенного локуса COI-COII мтДНК, исследуемые и сравниваемые выборки пчел можно классифицировать следующим образом: пасеки со значениями частот PQ, PQQ, PQQQ - 0.95-1.00 относить к чистопродным с высоким уровнем содержания семей A.m.mellifera (или митотип М, по аналогии с классификацией Ruttner et al., 1978, основанной на общем фенотипе пчел); со значениями 0.51-0.94 - к гибридным пасекам с низким уровнем гибридизации (митотип М-С); со значениями 0.00-0.50 - к гибридным пасекам с высоким уровнем гибридизации (митотип С-М). С учетом приведенной выше классификации, пять пасек изучаемых районов (г. Бирска ул. Фрунзе и ул. Курбатово, д. Вязовка Бирского района, пасека Салиева д. Камеево Мишкинского района и пасека д. Абызово Караидельского района) мы отнесли к митотипу М-С; иглинскую выборку - к митотипу С-М; остальные 42 пасеки - к митотипу М. Таким образом, полученные нами высокие показатели частот встречаемости комбинаций PQ, PQQ, PQQQ межгенного локуса COI-COII мтДНК (0.94-0.98), позволяют утверждать о сохранении в исследуемых районах темной лесной пчелы. Таким образом, популяция северного ареала башкирской пчелы A.m.mellifera характеризуется устойчивым соотношением внутри- и межгрупповой компонент генного разнообразия, что отражает баланс процессов интеграции и дифференциации видового генофонда. Данное равновесное соотношение может сохраняться только при стабильных значениях популяционных характеристик (F-коэффициенты и гетерозиготность) на исторически сложившемся оптимальном уровне. Анализ структуры популяции медоносной пчелы северного ареала Республики Башкортостан по морфометрическим данным показал наличие 79% пасек с содержанием семей А.m.mellifera и 21% - с присутствием гибридных пчелиных семей. Кластерный анализ по данным морфометрических исследований экстерьерных признаков позволил отнести популяцию медоносной пчелы северного ареала Республики Башкортостан (Бирский, Мишкинский, Караидельский районы) к подвиду A.m.mellifera. Высокие уровни показателей частот встречаемости комбинаций, характеризующих пчел A.m.mellifera (PQ, PQQ, PQQQ), межгенного локуса COI-COII мтДНК, в целом, по исследуемым районам (0.94-0.98) позволяют говорить об их происхождении от темной лесной пчелы по материнской линии. Анализ полиморфизма микросателлитных локусов ар243, 4а110 и А8 ядерной ДНК выявил генетическое родство между исследуемой популяцией северного ареала башкирской пчелы и сравниваемыми бурзянской и татышлинской. Анализ F-статистики и гетерозиготности в популяции северного ареала башкирской пчелы позволили выявить отсутствие статистически значимой генетической дифференциации (FST = 0.015) и инбридинга (FIS=0.122 и FIT=0.135), а близкие значения наблюдаемых (0.435) и ожидаемых (0.485 и 0.493) значений гетерозиготности отражают равновесное состояние популяции по Харди-Вайнбергу. The aim of research was to study the structure of the honey bee population of the northern area of the Republic of Bashkortostan in the comparative population-genetic aspect. According to the results of morphometric studies in Birsk, Mishkinskoye and Karaidelsky District of the Republic of Bashkortostan 79% of the apiaries were attributed to the dark forest bee subspecies A.m.mellifera, 21% of apiaries - bees hybrid origin. These morphometric studies fully confirmed the data obtained on the basis of polymorphism of the intergenic locus COI-COII mtDNA and the results of the analysis of variability of microsatellite loci ar243, 4a110 and A8 nuclear DNA. The results of analysis of polymorphism of the intergenic locus COI-COII mtDNA showed that the incidence of PQQ combination (Table 1.) Bees studied areas ranged from 0.00 (2 apiary Birsk district - d Vyazovka and e Starobazanovo 4 apiary Karaidelsky District - d Taykash... , d. bike Yunusov and d. New Akbulyak) to 1.00 in the absolute majority of the studied apiaries. Comparing the values of the frequencies of occurrence of combinations intergenic locus COI-COII mtDNA, studied and compared samples of bees can be classified as follows: apiary with the values of PQ frequencies, PQQ, PQQQ - 0.95-1.00 chistoprodnym attributed to the high level of family content Ammellifera (or mitotype M ., by analogy with the classification Ruttner et al, 1978, based on the overall phenotype bees); with values of 0.51-0.94 - a hybrid apiaries low hybridization (mitotype M-C); with values of 0.00-0.50 - a hybrid high-apiaries hybridization (mitotype C-M). In view of the above classification, five apiaries studied areas (Birsk st. Frunze Str. Kurbatov, d. Vyazovka Birsk district apiary Salieva d. Kameevo Mishkinsky area and apiary on. Abyzova Karaidelsky District), we attributed to mitotype M-C ; Iglinskiy sample - to mitotype C-M; the remaining 42 apiary - to mitotype M. Thus, we have obtained high rates of occurrence of combinations of frequencies PQ, PQQ, PQQQ intergenic locus COI-COII mtDNA (0.94-0.98) suggest the preservation of the studied areas in the dark forest bees. Thus, the population of the northern area of the Bashkir bee A.m.mellifera characterized by a steady ratio of intra- and intergroup components of genetic diversity, which reflects the balance of the processes of integration and differentiation of the species gene pool. This equilibrium relationship can only be maintained with stable values of population characteristics (F-ratios and heterozygosity) on historical optimum level. Analysis of the structure of the honey bee population of the northern area of the Republic of Bashkortostan on the morphometric data showed the presence of 79% of apiaries containing A.m.mellifera families and 21% - with the presence of hybrid bee colonies. Cluster analysis according to morphometric studies of exterior signs allowed to carry a population of honeybee northern area of the Republic of Bashkortostan (Birsk, Mishkinskoye, Karaidelsky District) to the subspecies A.m.mellifera. High levels of performance combinations of frequencies of occurrence, characterizing the bees A.m.mellifera (PQ, PQQ, PQQQ), intergenic locus COI-COII mtDNA, as a whole, according to the study area (0.94-0.98) suggest their origin from the dark forest bees through the maternal line. Analysis of polymorphism of microsatellite loci ar243, 4a110 and A8 nuclear DNA revealed the genetic relationship between the studied population of the northern area of the Bashkir bee compare Burzyan and tatyshlinskoy. Analysis of the F-statistic and heterozygosity in the northern area of the population of Bashkir bee revealed no statistically significant genetic differentiation (FST = 0.015) and inbreeding (FIS = 0.122 and FIT = 0.135), but similar values observed (0.435) and expected (0.485 and 0.493) heterozygosity values reflect the equilibrium state of a population of Hardy-Weinberg.
  190. Николенко А.Г., Ильясов Р.А., Поскряков А.В. Глава 5.6. Ареал бурзянской популяции темной лесной пчелы. В книге: Темная лесная пчела Apis mellifera mellifera L. Республики Башкортостан / Ред. Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина. Москва: Товарищество научных изданий КМК, 2016. С. 236-243. ISBN 978-5-9908416-0-4. 320 с., 20 вкл. (Nikolenko G. Alexei, Ilyasov A. Rustem, Poskryakov V. Alexandr. Chapter 5.6. The area of distribution of Burzyan dark forest bees. In: Ilyasov R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis mellifera mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov, A.G. Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press, 2016. P. 236-243. ISBN 978-5-9908416-0-4. 320 p., 20 color inserts.)
Николенко А.Г., Ильясов Р.А., Поскряков А.В. Глава 5.6. Ареал бурзянской популяции темной лесной пчелы. В книге: Темная лесная пчела Apis mellifera mellifera L. Республики Башкортостан / Ред. Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина. Москва: Товарищество научных изданий КМК, 2016. С. 236-243. ISBN 978-5-9908416-0-4. 320 с., 20 вкл. (Nikolenko G. Alexei, Ilyasov A. Rustem, Poskryakov V. Alexandr. Chapter 5.6. The area of distribution of Burzyan dark forest bees. In: Ilyasov R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis mellifera mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov, A.G. Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press, 2016. P. 236-243. ISBN 978-5-9908416-0-4. 320 p., 20 color inserts.) Пробы по 10 пчел из 495 семей (132 пасеки, 35 населенных пунктов, 22 борти) собраны в 2008-2010 гг. на территории Бурзянского и граничащих с ним районов Республики Башкортостан. ДНК выделяли из мышц торакса медоносной пчелы, фиксированной в 96% этаноле. Выделение проводили по ранее описанному методу смесью гуанидинтиоцианат-фенол-хлороформ (Chomzynski, Sacchi, 1987). Географическое распределение вариантов локуса COI-COII мтДНК показано на рис. 1. Наблюдается разделение генофонда медоносной пчелы на три зоны. В центре присутствует только вариант PQQ, далее идут две области, где появляется вариант PQQQ, а в двух выборках - PQ. По периметру расположены выборки, включающие вариант Q. Таким образом, географическое распределение вариантов локуса COI-COII можно интерпретировать следующим образом. В выборках на всей территории Бурзянского района вариант PQQ наблюдается с частотой 1.00, что, возможно, соответствует центральной зоне ареала. В 1928-1929 гг. экспедиция Г.А. Кожевникова отметила зону скопления обслуживаемых бортей на несколько меньшей территории, вблизи деревень Галиакберово, Гадельгареево, Мунасипово и Старосубхангулово (Кожевников, 1931). На севере и юго-востоке наблюдаются две области, где помимо основного варианта PQQ, присутствует вариант PQQQ (0.29-1.00), а в двух выборках - вариант PQ (0.12 и 0.25). Обе области расположены вдоль транспортных магистралей на пути к Бурзянскому району, что допускает возможность завоза пчелиных семей извне. Эти области мы отнесли к периферии ареала - краевым зонам. Располагающаяся по периметру карты область с присутствием варианта Q свидетельствует о приближении к зоне гибридизации подвидов. Для анализа полиморфизма четырех микросателлитных локусов Ap243, 4A110, A24 и Ap049 яДНК были использованы только выборки достаточного размера (близкие к величине 20 пчелиных семей из одного или двух близко расположенных населенных пунктов). Для сравнения взяты ранее полученные данные по аналогичным выборкам из популяций Урала и Прикамья, а также из популяций южных подвидов. Были рассчитаны величины Fst и построена дендрограмма, отражающая генетические отношения субпопуляций (рис. 2). Анализ полиморфизма мтДНК (рис. 1) свидетельствует об отсутствии сколько-нибудь существенного завоза пчелиных семей на территорию Бурзянского района. Этому способствуют как менталитет жителей, так и меры администрации района. Маловероятен и значительный вывоз семей за пределы района. Основным фактором необычного, узко протяженного выравнивания генофонда по яДНК в обоих случаях может выступать лишь интенсивный поток генов в виде трутневого фона. В качестве дополнительного фактора сглаживания различий между центром и периферией можно предположить трутневый фон свободно обитающих пчел: субпопуляции кластеров расположены вдоль почти необитаемых лесов на хребтах Южного Урала и водозаборах рек Нугуш, Ик и др. Показано генетическое родство (разной степени) бортевых пчел с пасечными пчелиными семьями в пределах ареала популяции. Генетические процессы между ними требуют отдельного обсуждения. Генетическая уникальность как бортевой, так и бурзянской популяции в целом предполагалась многими авторами (Газизов, 2007), однако нам впервые удалось показать на подробном экспериментальном материале генетическую дифференциацию бурзянской популяции от большинства популяций Урала и Поволжья. Полученные результаты позволяют предполагать существование двойной генетической границы ареала, которая должна быть присуща естественной (длительно существующей) популяции медоносной пчелы в силу биологических особенностей вида: радиус удаления от семьи матки и трутней во время спаривания может достигать 12 км, дальность полета пчелиного роя - 40 км и более. Впрочем, двойная генетическая граница должна быть свойственна и популяциям многих видов с протяженным сплошным ареалом. Показано существование естественного интенсивного трутневого фона - третьего (не по значимости) механизма, определяющего генетическую стабильность естественной популяции, помимо изоляции и социального фактора, известных ранее: активное ядро генофонда популяции формирует краевые зоны, которые, в свою очередь, защищают это ядро. Таким образом, помимо искусственных технологий - популяции закрытого типа и принципа двойной замены маток - возможна стратегия естественного сохранения генофонда медоносной пчелы, дающая более стабильный результат. The samples of 10 bees from 495 families (132 apiaries, 35 settlements, 22 boards) collected in 2008-2010. Burzyansky on site and neighboring areas of the Republic of Bashkortostan. DNA was isolated from the muscles of the thorax of the honey bee, fixed in 96% ethanol. Isolation was performed according to the method previously described mixture of guanidine thiocyanate-phenol-chloroform (Chomzynski, Sacchi, 1987). The geographic distribution of variants of locus COI-COII mtDNA is shown in Fig. 1. There is a separation of the honey bee gene pool into three zones. In the center there is only the option of PQQ, two areas where there is an option PQQQ go further, and in two samples - PQ. Along the perimeter of the sample are located, including the option Q. Thus, the geographic distribution of variants locus COI-COII can be interpreted as follows. The samples on the entire territory of the district Burzyansky PQQ variant occurs with a frequency of 1.00, which may correspond to the area of the central zone. In 1928-1929 gg. Expedition GA Kozhevnikova said accumulation zone served aboard several smaller areas near the villages Galiakberova, Gadelgareevo, Munasipovo and Starosubkhangulovo (Kozhevnikov, 1931). In the north and south-east there are two areas, where in addition to the basic variant of PQQ, there is an option PQQQ (0.29-1.00), and in two samples - version of PQ (0.12 and 0.25). Both areas are located along the highways on the way to Burzyansky District, which allows for the possibility of importation of bee colonies outside. These areas we carried to the periphery of the area - the boundary zones. Located on the perimeter of the area of the map with the presence of variant Q indicates the approaching zone subspecies hybridization. For the analysis of polymorphisms of four microsatellite loci Ap243, 4A110, A24 and Ap049 only nuclear DNA of sufficient size samples were used (close to the value of 20 bee colonies of one or two nearby settlements). For comparison, the data previously taken on similar samples from populations of the Urals and the Kama region, as well as the populations of the southern subspecies. Fst values were calculated and constructed dendrogram showing the genetic relationships subpopulations (Fig. 2). Analysis of mtDNA polymorphism (Fig. 1) indicates the absence of any significant importation of bee colonies in the territory Burzyansky area. It is promoted as the mentality of the inhabitants, and the measures of the district administration. Is unlikely and substantial removal of families outside the area. The main factor of the ordinary, narrow elongated alignment of the gene pool by nuclear DNA in both cases, can act only intensive gene flow in the form of a background drone. An additional factor, smoothing the differences between the center and the periphery can assume male bee background freely living bees: subpopulation clusters located along the almost uninhabited forests on the ridges of the Southern Urals and intakes Nugush rivers Ik and others. Displaying genetic relatedness (of varying degrees) with wild-hive bee bee bee families within the range of the population. Genetic processes between them require a separate discussion. The genetic uniqueness as a wild-hive and Burzyan the general population assumed by many authors (Gazizov, 2007), but we were able to show for the first time on a detailed experimental material genetic differentiation Burzyan populations of most populations of the Urals and the Volga region. These results suggest the existence of a double genetic border of the area that should be inherent in the natural (continuous current) population of honey bees due to the biological characteristics of species: the radius of the removal of the uterus and drones family during mating can reach 12 km, range beehive - 40 km and more. However, the double border should be a genetic characteristic of many populations and species with extended continuous habitat. The existence of natural background of intense drone - the third (not least) the mechanism that determines the genetic stability of the natural populations, in addition to isolation and social factor, previously known: the active nucleus of the gene pool of the population forms the boundary zone, which, in turn, protect this core. Thus, in addition to man-made technology - gated population and the principle of double replacement ewes - Possible strategies of natural preservation of the gene pool of the honey bee, which gives a more stable result.
  189. Фархутдинов Р.Г., Ильясов Р.А., Юмагужин Ф.Г., Уразбахтина Н.А., Туктарова Ю.В., Шафикова В.М., Абдуллин М.Ф. Глава 4.7. Применение фитосбора для лечения аскосфероза темной лесной пчелы башкирской популяции. В книге: Темная лесная пчела Apis mellifera mellifera L. Республики Башкортостан / Ред. Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина. Москва: Товарищество научных изданий КМК, 2016. С. 162-172. ISBN 978-5-9908416-0-4. 320 с., 20 вкл. (Farkhutdinov G. Rashit, Ilyasov A. Rustem, Yumaguzhin G. Fitrat, Urazbakhtina A. Nuriya, Tuktarova V. Yuliya, Shafikova M. Venera, Abdullin F. Marat. Chapter 4.7. The use of drugs on the basis of phytoextracts (extracts of drug plants) against ascospaerosis (Ascospaera apis) in the native population of dark forest bees. In: Ilyasov R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis mellifera mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov, A.G. Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press, 2016. P. 162-172. ISBN 978-5-9908416-0-4. 320 p., 20 color inserts.)
Фархутдинов Р.Г., Ильясов Р.А., Юмагужин Ф.Г., Уразбахтина Н.А., Туктарова Ю.В., Шафикова В.М., Абдуллин М.Ф. Глава 4.7. Применение фитосбора для лечения аскосфероза темной лесной пчелы башкирской популяции. В книге: Темная лесная пчела Apis mellifera mellifera L. Республики Башкортостан / Ред. Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина. Москва: Товарищество научных изданий КМК, 2016. С. 162-172. ISBN 978-5-9908416-0-4. 320 с., 20 вкл. (Farkhutdinov G. Rashit, Ilyasov A. Rustem, Yumaguzhin G. Fitrat, Urazbakhtina A. Nuriya, Tuktarova V. Yuliya, Shafikova M. Venera, Abdullin F. Marat. Chapter 4.7. The use of drugs on the basis of phytoextracts (extracts of drug plants) against ascospaerosis (Ascospaera apis) in the native population of dark forest bees. In: Ilyasov R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis mellifera mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov, A.G. Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press, 2016. P. 162-172. ISBN 978-5-9908416-0-4. 320 p., 20 color inserts.) Эффективность лечебных обработок пчелиной семьи определяли сравнением количества пораженных аскосферозом личинок. Подсчет количества инфицированных личинок проводился каждую декаду в течение 2-х месяцев. Влияние подкормок на продуктивные показатели оценивали по методикам, принятым в зоотехнии (Лебедев и др., 2007; Туктаров, Галиуллин, 2011). Нами был проведен сравнительный анализ фунгицидных свойств спиртовых и водных экстрактов растительного сбора, для коррекции рецептуры сбора. Было установлено, что спиртовые экстракты растительного сбора более активны по отношению к A. apis по сравнению с водными, что, видимо, связано с определенным соотношением веществ спиртового экстракта (табл. 2). Как видно из табл. 2, уровень фунгицидного действия спиртового экстракта растительного сбора был близок к величине воздействия нистатина на грибной газон A. apis. Примерно на 20% площадь газона, росшего на агаре, содержащем спиртовой экстракт, была больше, чем на среде с нистатином. В варианте с водным экстрактом площадь была больше на 215% по сравнению с нистатином и на 180% по сравнению со спиртовым экстрактом. Возвращаясь к табл. 1, мы можем сделать предположение, что преобладание определенных групп веществ в спиртовом растворе обеспечивает более высокие фунгицидные свойства, что необходимо будет учитывать при стандартизации готового препарата по действующим веществам при введении его в производство. Определение антигрибкового действия экстрактов отдельных растений, входящих в состав сбора, показало, что активность была различной. В определенной степени это связано с тем, что помимо растений фунгицидного действия, в его состав были включены растения, обладающие стимулирующими свойствами. Наиболее эффективными в фунгицидном действии по отношению к A. api - оказались экстракты травы вероники, чистотела, листа березы, хвои пихты и чеснока. Однако суммарное фунгицидное действие фитосбора было выше, чем отдельных его компонентов, т.е. можно судить об их синергетическом действии. Влияния экстракта растительного сбора на активность ферментов, содержание запасных и минеральных веществ в теле пчел. Благополучие зимовки пчел зависит от многих факторов: зимостойкости пчел, формирования гнезда, количества и качества корма, условий зимовки, подготовки пчел к зимовке, ухода за пчелами, состояния их здоровья и др. (Жеребкин, 1979). Применение в лечении пчелиных семей препаратов, состоящих из природных компонентов, помогает избегать многих побочных эффектов, так как их механизмы основаны на активации естественных защитных реакций организма (Хамадиева и др., 2012). Нами было установлено положительное влияние подкормки сиропом с экстрактом фитопрепаратов на увеличение активности ферментов каталазы и пероксидазы, как показателей зимостойкости пчел. Так, в ноябре месяце (в пчелиных семьях обычно в это время сформирован клуб) нами были определены активности ферментов каталазы и пероксидазы в кишечнике пчел. Результаты показали, что активность фермента каталазы была выше в 1 группе (экстракт родиолы розовой) на 88%, а во 2 группе (экстракт фитосбора) - на 58% по сравнению с 3 контрольной группой (табл. 3). Активность фермента пероксидазы была выше в 1 группе на 16%, а во 2 группе - на 9% по сравнению с 3 контрольной группой. Это дает основание, опираясь на данные литературы (Хамадиева и др., 2012; Салтыкова и др., 2007; Брандорф, Ивойлова, 2011), предполагать, что осенняя подкормка пчелиных семей сиропом с экстрактом растительного сбора приводит к лучшей подготовке пищеварительной системы пчел к длительному безоблетному периоду во время зимовки. Определение количества расплода показало, что матки больше всего откладывали яица во 2 группе: на 26% и на 13% по сравнению с контролем в 1 группе. Определение силы семьи показало, что применение препаратов (нистатина и сбора) привело к увеличению числа пчел примерно в среднем на 13% и 25% соответственно. Таким образом, было установлено, что растительный сбор в условиях in vitro обладал фунгицидным действием. При подкормке пчел сиропом с экстрактом растительного сбора, обладающего фунгицидным и стимулирующим действием, происходило оздоровление расплода пчел, улучшение развития семьи, повышение зимостойкости и продуктивности. We carried out a comparative analysis of the fungicidal properties of alcohol and aqueous extracts of plant collection, for the collection of recipe correction. It was found that alcoholic extracts of plant collecting more active against A. apis compared with water that is apparently associated with a certain ratio of alcoholic extract substances (Table. 2). As can be seen from Table. 2, the level of fungicidal activity of plant collecting alcoholic extract was close to the magnitude of the impact of nystatin on fungal lawn A. apis. Approximately 20% of the lawn area that grew on agar containing an alcoholic extract, is greater than the medium with nystatin. In an area with the aqueous extract was higher by 215% compared to nystatin and 180% compared with the alcoholic extract. Returning to the table. 1, we can make the assumption that the prevalence of certain groups of substances in alcohol solution provides higher fungicidal properties that need to be taken into account in the standardization of the finished product for active substances when introduced into production. Determination of the antifungal activities of certain plant extracts that make up the collection, showed that the activity was different. To some extent, this is due to the fact that the fungicidal activity than plants in its composition included plants with stimulating properties. The most effective fungicidal action in relation to A. api - were extracts of herbs veronica, celandine, birch leaves, fir needles and garlic. However, the total fitosbora fungicidal effect was greater than its individual components, i.e. You can judge their synergistic effect. Effects of plant extract on the enzyme activity of collecting, content replacement and minerals in the body of the bees. Welfare wintering bees depends on many factors: hardiness of bees, forming nest, the quantity and quality of food, winter conditions, training bees to winter in, the care of bees, their health status, etc. (Zherebkin, 1979).. The use in the treatment of bee colonies preparations consisting of natural components, avoids many of the side effects, since their mechanisms are based on the activation of natural defense reactions (Hamadieva et al., 2012). We have found positive effects feeding syrup with an extract of herbal remedies to increase the activity of enzymes catalase and peroxidase as indicators hardiness of bees. So, in November (in bee colonies is usually at this time formed the club), we define the activity of catalase and peroxidase enzymes in the gut of bees. The results showed that the enzyme catalase activity was higher in group 1 (Rhodiola rosea extract) was 88%, while in group 2 (Extract fitosbora) - by 58% compared to the control group 3 (Table 3.). The enzyme activity of peroxidase was higher in Group 1 at 16%, and in group 2 - 9% compared to the control group 3. This gives grounds for relying on literature data (Hamadieva et al, 2012;. Saltykov, and others, 2007;. Brandorf, Ivoilova 2011), suggests that the autumn feeding bee colonies syrup with an extract of the plant collection leads to a better digestive system preparation bees to bezobletnomu prolonged period during the winter. Quantification brood showed that most delayed uterine eggs in Group 2: 26% and 13% compared to the control group in 1. Determination force family revealed that the use of drugs (and collection nystatin) has increased the number of bees on average approximately 13% and 25% respectively. Thus, it was found that the plant charge under in vitro fungicidal activity possessed. When feeding bees syrup with an extract of the plant collection, having fungicidal and stimulating effect, there was improvement of the brood of bees, improvement of family development, increase productivity and winter hardiness.
  188. Ильясов Р.А., Косарев М.Н., Юмагужин Ф.Г. Глава 1.5. Современная популяция бурзянской бортевой темной лесной пчелы на Южном Урале. В книге: Темная лесная пчела Apis mellifera mellifera L. Республики Башкортостан / Ред. Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина. Москва: Товарищество научных изданий КМК, 2016. С. 26-29. ISBN 978-5-9908416-0-4. 320 с., 20 вкл. (Ilyasov A. Rustem, Kosarev N. Michail, Yumaguzhin G. Fitrat. Chapter 1.5. The modern population of Burzyan wild-hive dark forest bees in the southern Urals. In: Ilyasov R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis mellifera mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov, A.G. Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press, 2016. P. 26-29. ISBN 978-5-9908416-0-4. 320 p., 20 color inserts.)
Ильясов Р.А., Косарев М.Н., Юмагужин Ф.Г. Глава 1.5. Современная популяция бурзянской бортевой темной лесной пчелы на Южном Урале. В книге: Темная лесная пчела Apis mellifera mellifera L. Республики Башкортостан / Ред. Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина. Москва: Товарищество научных изданий КМК, 2016. С. 26-29. ISBN 978-5-9908416-0-4. 320 с., 20 вкл. (Ilyasov A. Rustem, Kosarev N. Michail, Yumaguzhin G. Fitrat. Chapter 1.5. The modern population of Burzyan wild-hive dark forest bees in the southern Urals. In: Ilyasov R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis mellifera mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov, A.G. Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press, 2016. P. 26-29. ISBN 978-5-9908416-0-4. 320 p., 20 color inserts.) Темная лесная пчела Apis mellifera mellifera - уникальный подвид медоносной пчелы Apis mellifera, эволюционно приспособленный к обитанию в условиях континентального климата Северной Европы с длительными холодными зимами. На современном этапе развития пчеловодства пчелы этого подвида сохранились лишь в немногочисленных изолятах в виде небольших островков в Европе. Самые многочисленные массивы темной лесной пчелы в Европе имеются в России: около 300 000 слабо затронутых стихийной гибридизацией семей в Республике Башкортостан на Южном Урале, около 200 000 семей в Пермском крае на Среднем Урале (Шураков и др., 1999; Ильясов и др., 2006) и около 250 000 семей в Республике Татарстан в Поволжье (Кривцов, Гранкин, 2004). Есть сведения о сохранении значительных массивов темной лесной пчелы в Республике Удмуртия, Кировской области и Алтайском крае (Ильясов и др., 2007a; Кривцов, 2011; Брандорф и др., 2012). Примерно 99% семей темной лесной пчелы на Южном Урале содержится в рамочных ульях и около 1% обитает в лесах в естественных и искусственных (бортях и колодах) дуплах в стволах деревьев, преимущественно в Бурзянском районе Республики Башкортостан (рис. 1). В настоящее время темные лесные пчелы, обитающие в бортях, колодах и естественных дуплах, сохранились на Южном Урале в государственном заповеднике «Шульган-Таш» площадью 22 000 га (создан в 1958 г.), региональном природном заказнике «Алтын Солок» площадью 90 000 га (учрежден в 1997 г.) и национальном парке «Башкирия» площадью 82 000 га (образован в 1986 г.) (Косарев, 2008). В конце 2014 г. в период очередной популяционной депрессии на территории заповедника, заказника и национального парка имелось более 1200 деревьев с бортями и колодами, из которых было заселено около 300 искусственных дупел. Примерно 4 000 пчелиных семей бурзянской бортевой темной лесной пчелы в этой зоне содержится на пасеках с рамочными ульями, а в естественных дуплах по данным экстраполяции учетных материалов обитает 200-400 «дичков». В 2012 г. перечисленные особо охраняемые природные территории вместе с рядом иных получили статус комплексного биосферного резервата ЮНЕСКО «Башкирский Урал» общей площадью 346 000 га, а региональный заказник «Алтын Солок» стал реально охраняться Минэкологией Республики Башкортостан. В настоящее время с целью сохранения бурзянской бортевой темной лесной пчелы и в рамках развития резервата планируется расширение территории заповедника «Шульган-Таш» в северо-западном направлении за счет неосвоенной территории в междуречье рек Нугуш и Урюк (Косарев и др., 2002; Юмагужин, 2009). Сотрудники заповедника «Шульган-Таш», заказника «Алтын Солок» и национального парка «Башкирия» совместно с местными пчеловодами постоянно проводят мероприятия по оптимизации численности и селекционную работу по повышению иммунитета, зимостойкости и продуктивности семей бурзянской бортевой темной лесной пчелы, распространению опыта бортевого пчеловодства. Такая политика государственных природоохранных учреждений позволяет сохранять уникальную популяцию бортевых пчел - изолят A.m.mellifera в Европе в условиях новых угроз стихийной гибридизации и разрушения мест обитания (Юмагужин, 2009; Косарев и др., 2011). The dark forest bee Apis mellifera mellifera - a unique subspecies of the honeybee Apis mellifera, evolutionarily adapted to life in conditions of Northern Europe continental climate with long cold winters. At the present stage of development of bee bee this subspecies survived only a few isolates in the form of small islands in Europe. The largest tracts of dark forest bees in Europe are in Russia. About 300,000 slightly affected by natural families hybridization in the Republic of Bashkortostan in the southern Urals, nearly 200 000 families in the Perm region in the Middle Urals (Shurakov et al, 1999; Ilyasov et al. 2006) and about 250 000 families in the Republic of Tatarstan in the Volga region (Krivtsov, Grankin, 2004). There is information on the conservation of significant arrays dark forest bees in the Republic of Udmurtia, Kirov Region and the Altai Territory (Ilyasov et al, 2007a;. Krivtsov 2011; Brandorf et al, 2012.). Approximately 99% of households dark forest bees in the Southern Urals is contained in frame beehives and about 1% lives in the forests of natural and artificial (board and decks) hollows in tree trunks, mostly in Burzyansky District Republic of Bashkortostan (Fig. 1). At present, the dark forest bees that live in the board, decks and natural hollows have been preserved in the southern Urals in the State Reserve "Shulgan-Tash" area of 22 000 ha (established in 1958), the regional nature reserve "Altyn Solok" an area of 90 000 ha (established in 1997) and the national park "Bashkiria" area of 82 000 ha (founded in 1986) (Kosarev, 2008). At the end of 2014, another period of depression population in the reserve, the reserve and the national park had more than 1,200 trees to the sides and decks of which was inhabited around 300 artificial hollows. Approximately 4000 wild-hive bee colonies Burzyan dark forest bees in this area contained in the apiaries with framed hives and 200-400 "wildings" dwells in natural cavities according to the extrapolation of accounting materials. In 2012, the listed protected areas, along with several other granted the status of UNESCO biosphere reserve complex "Bashkir Ural" with total area of 346 000 hectares, and the regional reserve "Altyn Solok" was actually protected by the Ministry of Environment of the Republic of Bashkortostan. Currently, in order to preserve Burzyan wild-hive dark forest bees and in the development of the reserve is planned to expand the territory of "Shulgan-Tash" reserve in the north-west by undeveloped area between the rivers Nugush and Uruk (Kosarev et al., 2002; Yumaguzhin, 2009). Reserve staff "Shulgan-Tash" reserve "Altyn Solok" and national park "Bashkiria", together with local beekeepers is constantly taking measures to optimize the number and selection work to improve immunity, hardiness and productivity of families Burzyan wild-hive dark forest bees, extension wild-hive beekeeping . Such a policy of state environmental agencies allows you to save a unique population of wild-hive bee - isolate A.m.mellifera in Europe in the face of new threats spontaneous hybridization and habitat destruction (Yumaguzhin, 2009; Kosarev et al, 2011.).
  187. Ильясов Р.А., Николенко А.Г., Сайфуллина Н.М. Темная лесная пчела Apis mellifera mellifera L. Республики Башкортостан. Под ред. Р.А. Ильясова, А.Г. Николенко, Н.М. Сайфуллиной. Москва: Товарищество научных изданий КМК, 2016. 320 с., 20 вкл. ISBN 978-5-9908416-0-4. (Ilyasov R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis mellifera mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov, A.G. Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press, 2016. 320 p., 20 color inserts. ISBN 978-5-9908416-0-4.)
Ильясов Р.А., Николенко А.Г., Сайфуллина Н.М. Темная лесная пчела Apis mellifera mellifera L. Республики Башкортостан. Под ред. Р.А. Ильясова, А.Г. Николенко, Н.М. Сайфуллиной. Москва: Товарищество научных изданий КМК, 2016. 320 с., 20 вкл. ISBN 978-5-9908416-0-4. (Ilyasov R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis mellifera mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov, A.G. Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press, 2016. 320 p., 20 color inserts. ISBN 978-5-9908416-0-4.) Коллективная научная монография представляет собой собрание теоретических и экспериментальных работ сотрудников научных центров Республики Башкортостан, занимающихся решением задач по сохранению генофонда башкирской популяции темной лесной пчелы. Книга рекомендована для преподавателей, студентов, научных сотрудников, пчеловодов в качестве учебно-методического пособия, научно-практического руководства и справочника в области пчеловодства. The collective monograph is a collection of theoretical and experimental studies of the scientists of different scientific centers of the Republic of Bashkortostan involved in problems of the gene pool preservation of the dark forest bee of Bashkir population. This book recommended for teachers, students, researchers, beekeepers as scientific and practical manual, guide and reference book in the field of the beekeeping.
  186. Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Темная лесная пчела Apis mellifera mellifera Урала и Поволжья. Материалы международной научно-практической конференции «Современные проблемы пчеловодства и пути их решения». Москва: ФГБОУ ВО «РГАУ-МСХА имени К.А. Тимирязева». 10-12 марта 2016. С. 95-103.
Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Темная лесная пчела Apis mellifera mellifera Урала и Поволжья. Материалы международной научно-практической конференции «Современные проблемы пчеловодства и пути их решения». Москва: ФГБОУ ВО «РГАУ-МСХА имени К.А. Тимирязева». 10-12 марта 2016. С. 95-103.
Ilyasov R.A., Poskryakov A.V., Petukhov A.V., Nikolenko A.G. Dark european bee Apis mellifera mellifera of the Ural and Volga region. Proceedings of the international scientific-practical conference " Modern problems of beekeeping and their solutions». Moscow: FGBOU VO “RGAU-MSCHA named of K.A. Timiryazev”10-12 march 2016. P. 95-103.
Нами были изучены локальные популяции темной лесной пчелы A. m. mellifera Урала и Поволжья в сравнении с локальными популяциями пчел южных подвидов A. m. caucasica и A. m. carpatica Кавказа и Карпат. Генетический анализ проводился на основе полиморфизма 9 микросателлитных локусов ядерной ДНК и локуса COI-COII мтДНК. На территории Урала и Поволжья нами были выделены 5 сохранившихся популяций (резерватов) темной лесной пчелы A. m. mellifera: бурзянская, татышлинская, южно-прикамская, вишерская и камбарская. Эти пять популяций составляют основу современного генофонда темной лесной пчелы A. m. mellifera Урала и Поволжья. Основной массив сохранившегося аборигенного генофонда A. m. mellifera (ядро генофонда популяции A. m. mellifera) располагается на территории всего Пермского края и Севера Республики Башкортостан. Для популяции пчел A. m. mellifera Урала и Поволжья были рассчитаны генетические стандарты, которые будут полезны для последующих популяционных исследований медоносной пчелы.
Based on the spatial distribution of local populations in the Urals and the Volga region identified five surviving populations ( reserves ) dark forest bees A. m. mellifera: Burzyan, tatyshlinskaya, South Prikamskaya, Visherskaya and Kambarka. This population is currently characterized by a sufficient number of stable and balanced genetic and genotypic structure and a small deviation in the distribution of genotype frequencies from the equilibrium distribution of Hardy– Weinberg. To successfully save us five isolated populations of a dark forest bees in the Urals and the Volga region it is necessary to continuously monitor and control their gene pool in accordance with the principles of population genetics.
  185. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Селекция на основе генетических характеристик. Пчеловодство. 2016. № 8. С. 12-15.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Селекция на основе генетических характеристик. Пчеловодство. 2016. № 8. С. 12-15.
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. A selection of the dark forest bee A. m. mellifera colonies based on the genetic characteristics (translated). Russian Journal of Beekeeping “Pchelovodstvo”. 2016. No. 8. P. 12-15.
Проведен молекулярно-генетический анализ популяций и семей темной лесной пчелы A. m. mellifera Урала и Поволжья в сравнении с популяциями пчел южных подвидов A. m. caucasica и A. m. carpatica Кавказа и Карпат на основе полиморфизма 9 микросателлитных локусов яДHK. В статье рассчитаны генетические характеристики для популяции (Ho=0.24, Hs=0.23, Ht=0.28, Fis=0.06, Fit=0.14, Fst=0.17) и семьи (Ho=0.20, Hs=0.16, Ht=0.15, Fis=0.23, Fit=0.35, Fst=0.11) темной лесной пчелы A. m. mellifera и предложена методика селекции семей темной лесной пчелы с интрогрессией “южных” генов не более 5%, и генетическими показателями, характерными для чистопородных семей A. m. mellifera (Ho ≤ 0.30, Hs ≤ 0.30, Ht ≤ 0.30, Fis ≤ │0.45│, Fit ≤ │0.55│, Fst ≥ │0.11│).
A molecular genetic analysis of populations and colonies of the dark forest bee A. m. mellifera from the Urals and the Volga region in comparison with populations of the bees of southern subspecies A. m. caucasica and A. m. carpatica from the Caucasus and the Carpathians have carried out based on the polymorphism 9 microsatellite loci of the nuclear DNA. The genetic characteristics of the population (Ho=0.24, Hs=0.23, Ht=0.28, Fis=0.06, Fit=0.14, Fst=0.17) and the colony (Ho=0.20, Hs=0.16, Ht=0.15, Fis=0.23, Fit=0.35, Fst=0.11) of the dark forest bee A. m. mellifera were calculated and the method of selection of the dark forest bee colonies with introgression of "southern" less than 5% and genetic characteristic of thoroughbred colonies A. m. mellifera (Ho ≤ 0.30, Hs ≤ 0.30, Ht ≤ 0.30, Fis ≤ │0.45│, Fit ≤ │0.55│, Fst ≥ │0.11│) was proposed in this article.
  184. Ilyasov R.A., Poskryakov A.V., Petukhov A.V., Nikolenko A.G. Molecular genetic analysis of five extant reserves of black honeybee Apis melifera melifera in the Urals and the Volga Region. Russian Journal of Genetics, 2016, V. 52, No. 8, P. 828–839. DOI: 10.1134/S1022795416060053.
Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Молекулярно-генетический анализ пяти сохранившихся резерватов темной лесной пчелы Apis mellifera mellifera Урала и Поволжья. Генетика. 2016. Т. 52. № 8. С. 931–942. (IF 0.446). DOI: 10.7868/S0016675816060059.
Ilyasov R.A., Poskryakov A.V., Petukhov A.V., Nikolenko A.G. Molecular genetic analysis of five extant reserves of black honeybee Apis melifera melifera in the Urals and the Volga Region. Russian Journal of Genetics, 2016, V. 52, No. 8, P. 828–839. DOI: 10.1134/S1022795416060053.
Изучены локальные популяции темной лесной пчелы Apis mellifera mellifera Урала и Поволжья в сравнении с локальными популяциями пчел южных подвидов A. m. caucasica и A. m. carpatica Кавказа и Карпат. Генетический анализ проводился на основе полиморфизма девяти микросателлитных локусов ядерной ДНК и локуса COI-COII мтДНК. На территории Урала и Поволжья нами были выделены пять сохранившихся популяций (резерватов) темной лесной пчелы A. m. mellifera: бурзянская, татышлинская, южно-прикамская, вишерская и камбарская. Эти пять популяций составляют основу современного генофонда темной лесной пчелы A. m. mellifera Урала и Поволжья. Основной массив сохранившегося аборигенного генофонда A. m. mellifera (ядро генофонда популяции A. m. mellifera) располагается на территории всего Пермского края и Севера Республики Башкортостан. Для популяции пчел A. m. mellifera Урала и Поволжья были рассчитаны генетические стандарты, которые бу дут полезны для последующих популяционных исследований медоносной пчелы.
Local populations of the black honeybee Apis mellifera mellifera from the Urals and the Volga region were examined in comparison with local populations of southern honeybee subspecies A. m. caucasica and A. m. carpatica from the Caucasus and the Carpathians. Genetic analysis was performed on the basis of the polymorphism of nine microsatellite loci of nuclear DNA and the mtDNA COI–COII locus. On the territory of the Urals and the Volga region, five extant populations (reserves) of the black honeybee A. m. mellifera were identified, including the Burzyanskaya, Tatyshlinskaya, Yuzhno-Prikamskaya, Visherskaya, and Kambarskaya populations. These five populations are the basis of the modern gene pool of the black honeybee A. m. mellifera from the Urals and the Volga region. The greatest proportion of the remaining indigenous gene pool of A. m. mellifera (the core of the gene pool of the population of A. m. mellifera) is distributed over the entire territory of Perm krai and the north of the Republic of Bashkortostan. For the population of A. m. mellifera from the Urals and the Volga region, the genetic standards were calculated, which will be useful for future population studies of honeybees.
  183. Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Молекулярно-генетический анализ пяти сохранившихся резерватов темной лесной пчелы Apis mellifera mellifera Урала и Поволжья. Генетика. 2016. Т. 52. № 8. С. 931–942. (IF 0.446). DOI: 10.7868/S0016675816060059.
Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Молекулярно-генетический анализ пяти сохранившихся резерватов темной лесной пчелы Apis mellifera mellifera Урала и Поволжья. Генетика. 2016. Т. 52. № 8. С. 931–942. (IF 0.446). DOI: 10.7868/S0016675816060059.
Ilyasov R.A., Poskryakov A.V., Petukhov A.V., Nikolenko A.G. Molecular genetic analysis of five extant reserves of black honeybee Apis melifera melifera in the Urals and the Volga Region. Russian Journal of Genetics, 2016, V. 52, No. 8, P. 828–839. DOI: 10.1134/S1022795416060053.
Изучены локальные популяции темной лесной пчелы Apis mellifera mellifera Урала и Поволжья в сравнении с локальными популяциями пчел южных подвидов A. m. caucasica и A. m. carpatica Кавказа и Карпат. Генетический анализ проводился на основе полиморфизма девяти микросателлитных локусов ядерной ДНК и локуса COI-COII мтДНК. На территории Урала и Поволжья нами были выделены пять сохранившихся популяций (резерватов) темной лесной пчелы A. m. mellifera: бурзянская, татышлинская, южно-прикамская, вишерская и камбарская. Эти пять популяций составляют основу современного генофонда темной лесной пчелы A. m. mellifera Урала и Поволжья. Основной массив сохранившегося аборигенного генофонда A. m. mellifera (ядро генофонда популяции A. m. mellifera) располагается на территории всего Пермского края и Севера Республики Башкортостан. Для популяции пчел A. m. mellifera Урала и Поволжья были рассчитаны генетические стандарты, которые бу дут полезны для последующих популяционных исследований медоносной пчелы.
Local populations of the black honeybee Apis mellifera mellifera from the Urals and the Volga region were examined in comparison with local populations of southern honeybee subspecies A. m. caucasica and A. m. carpatica from the Caucasus and the Carpathians. Genetic analysis was performed on the basis of the polymorphism of nine microsatellite loci of nuclear DNA and the mtDNA COI–COII locus. On the territory of the Urals and the Volga region, five extant populations (reserves) of the black honeybee A. m. mellifera were identified, including the Burzyanskaya, Tatyshlinskaya, Yuzhno-Prikamskaya, Visherskaya, and Kambarskaya populations. These five populations are the basis of the modern gene pool of the black honeybee A. m. mellifera from the Urals and the Volga region. The greatest proportion of the remaining indigenous gene pool of A. m. mellifera (the core of the gene pool of the population of A. m. mellifera) is distributed over the entire territory of Perm krai and the north of the Republic of Bashkortostan. For the population of A. m. mellifera from the Urals and the Volga region, the genetic standards were calculated, which will be useful for future population studies of honeybees.
  182. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Организация генома медоносной пчелы Apis mellifera. Биомика. 2016. Т. 8. № 2. С. 97-99.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Организация генома медоносной пчелы Apis mellifera. Биомика. 2016. Т. 8. № 2. С. 97-99. (Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. The honey bee Apis mellifera genome organisation (translated). Biomics. 2016. V. 8 (2). P. 97-99.)В статье представлен анализ ядерного и митохондриального геномов медоносной пчелы Apis mellifera в сравнении с геномом плодовой мушки Drosophila melanogaster. Ядерный геном медоносной пчелы размером около 245 млн. п. н. распределен между 16 хромосомами и содержит около 10 тыс. генов. Митохондриальный геном медоносной пчелы размером около 16 тыс. п. н. расположен в митохондриях и содержит 35 генов. Несмотря на полное секвенирование ядерного и митохондриального геномов медоносной пчелы, функции многих генов и локусов еще до конца не раскрыты. The analysis of the nuclear and the mitochondrial genomes of the honey bee Apis mellifera in comparison with genomes of fruit fly Drosophila melanogaster were showed in this article. The nuclear genome of the honey bee has about 245 millions b. p. which distributed in 16 chromosomes and contains about 10 thousands genes. The mitochondrial genome of the honey bee has about 16 thousands b. p. which located in mitochondrions and contains 35 genes. Despite the full sequencing of the nuclear and the mitochondrial genomes of the honey bee Apis mellifera the function of most genes and loci not clear yet.
  181. Каскинова М.Д., Ильясов Р.А., Поскряков А.В., Косарев М.Н., Шарипов А.Я., Николенко А.Г. Генетические показатели бурзянской популяции Apis mellifera mellifera L. Биомика. 2016. Т. 8. № 2. С. 117-124.
Каскинова М.Д., Ильясов Р.А., Поскряков А.В., Косарев М.Н., Шарипов А.Я., Николенко А.Г. Генетические показатели бурзянской популяции Apis mellifera mellifera L. Биомика. 2016. Т. 8. № 2. С. 117-124. (Kaskinova M.D., Ilyasov R.A., Poskryakov A.V., Кosarev М.N., Sharipov A.Y., Nikolenko A.G. The genetics parametres of the burzyan population of Apis mellifera mellifera L. (translated). Biomics. 2016. V. 8 (2). P. 117-124.)Для сохранения бурзянской популяции A. m. mellifera необходимо систематически оценивать ее генетические показатели с целью предупреждения ее гибридизации с другими подвидами. В данной работе приведены генетические показатели бурзянской популяции Apis m. mellifera L., полученные путем анализа полиморфизма локуса COI-COII мтДНК и микросателлитных локусов яДНК. В результате мы выяснили, что показатели генетического разнообразия исследуемой выборки пчелиных семей сопоставимы с соответствующими средними показателями, полученными в предыдущих исследованиях для бурзянской популяции. Также были обнаружены две пчелиные семьи гибридного происхождения по ядерному и митохондриальному геномам в с. Старосубхангулово на территории Бурзянского района. To conservation the Burzyan population of Apis mellifera mellifera L. it is necessary to systematically evaluate its genetic parameters in order to prevent its hybridization with other subspecies. This paper present genetic parameters of bee colonies of Burzyan dark forest honeybee population on the basis of polymorphism analysis of locus COI-COII mtDNA and nuclear DNA microsatellite loci. As a result, we found that the parameters of the genetic diversity of studied honeybee colonies correspond to the average value obtained in previous studies. The studies of the nuclear and mitochondrial genomes identified two hybrid origin bee colonies in the protected area of the reserve “Altyn-Solok”.
  180. Фархутдинов Р. Г., Юмагужин Ф. Г., Ильясов Р. А., Шафикова В. М. , Уразбахтина Н. А. Фитоаск - высокое качество зимовки семей, их весеннего развития и профилактика аскосфероза. Пчеловодство. 2016. №6. С. 29-32.
Фархутдинов Р. Г., Юмагужин Ф. Г., Ильясов Р. А., Шафикова В. М. , Уразбахтина Н. А. Фитоаск - высокое качество зимовки семей, их весеннего развития и профилактика аскосфероза. Пчеловодство. 2016. №6. С. 29-32.
Farkhutdinov R. G., Yumaguzhin F. G., Ilyasov R. A., Shafikova V. M., Urazbakhtina N. A. Fitoask - high quality of wintering and spring development of honey bee colonies and for the prevention ascosphaerosis (translated). Russian journal of beekeeping “Pchelovodstvo”. 2016. No. 6. P. 29-32.
В статье описан опыт осенней и весенней подкормки семей пчел препаратом «Фитоаск» растительного происхождения. Подкормка семей пчел препаратом «Фитоаск» повышает качество зимовки, поддерживает микробиоценоз кишечника, снижает заболеваемость аскосферозом, стимулирует весеннее развитие и повышает продуктивность.
The article describes the experience of spring and autumn feeding the honeybee colonies by medicinal plant extract "Fitoask". Feeding the honeybee colonies by medicinal plant extract "Fitoask" improves the quality of wintering, supports intestinal microbiocenosis, reduces the ascosphaerosis, stimulates the spring development and increases the honey productivity.
  179. Каскинова М. Д., Ильясов Р. А., Косарев М. Н., Поскряков А. В., Шарипов А. Я., Николенко А. Г. Оценка чистопородности семей темной лесной пчелы бурзянской популяции. Пчеловодство. 2016. №6. С. 20-23.
Каскинова М. Д., Ильясов Р. А., Косарев М. Н., Поскряков А. В., Шарипов А. Я., Николенко А. Г. Оценка чистопородности семей темной лесной пчелы бурзянской популяции. Пчеловодство. 2016. №6. С. 20-23.
Kaskinova M.D., Ilyasov R.A., Poskryakov A.V., Kosarev M.N., Sharipov A.Y., Nikolenko A.G. The assessment of the breed of the dark european bees colonies from the burzyan population (translated). Russian journal of beekeeping “Pchelovodstvo”. 2016. No. 6. P. 20-23.

Для принятия обоснованных решений по сохранению и управлению природной популяцией медоносной пчелы необходимо обладать актуальной информацией о состоянии ее генофонда. В данной работе проведена оценка генетических показателей пчелиных семей бурзянской популяции темной лесной пчелы Apis mellifera mellifera L. на основе анализа полиморфизма локуса COI-COII мтДНК и микросателлитных локусов яДНК. В результате проведенных исследований выявлены две завезенные пчелиные семьи гибридного происхождения в селе Старосубхангулово. Своевременное выявление пчелиных семей гибридного происхождения — обязательное условие сохранения генофонда чистопородных популяций темной лесной пчелы.

To make well-grounded decisions on conservation and management of natural populations of honey bee, we need to have the current information about the status of its gene pool. In this study we evaluated genetic parameters of bee colonies of Burzyan dark forest honeybee population of Apis mellifera mellifera L. on the basis of polymorphism analysis locus COI-COII mtDNA and nuclear DNA microsatellite loci. The studies of the nuclear and mitochondrial genomes identified two hybrid origin bee colonies. Timely detection of hybrid colonies will increase the chances of genetic conservation of native populations of the dark forest bees. Keywords: honey bee Apis mellifera L., Burzyan dark forest honeybee population, monitoring, genetic polymorphism microsatellites.
  178. Ильясов Р. А., Поскряков А. В., Петухов А. В., Николенко А. Г. Современные резерваты темной лесной пчелы на Урале и в Поволжье // Пчеловодство. 2016. № 5. С. 20-22.
Ильясов Р. А., Поскряков А. В., Петухов А. В., Николенко А. Г. Современные резерваты темной лесной пчелы на Урале и в Поволжье // Пчеловодство. 2016. № 5. С. 20-22.
Ilyasov R. A., Poskryakov A. V., Petukhov A. V., Nikolenko A. G. The current reserves of the dark European honey bee A. m. mellifera in the Ural and Volga region (translation) // Russian journal of beekeeping “Pchelovodstvo”. 2016. No. 5. P. 20-22.
Нами было проведено молекулярно-генетическое исследование локальных популяций темной лесной пчелы A. m. mellifera 49 районов Урала и Поволжья в сравнении с локальными популяциями пчел южных подвидов A. m. caucasica и A. m. carpatica на основе анализа полиморфизма 9 микросателлитных локусов Ap243, 4a110, A24, A8, A43, A113, A88, Ap049 и A28 и локуса COI-COII мтДНК. На территории Урала и Поволжья нами выделены 5 сохранившихся резерватов (локальных популяций) темной лесной пчелы A. m. mellifera: бурзянская (горно-лесная зона Республики Башкортостан), татышлинская (Север Республики Башкортостан), южно-прикамская (Юг и Центр Пермского края), вишерская (Север Пермского края), камбарская (Юг и Центр Республики Удмуртия).
We have carried out the molecular genetic research of the dark European bee A. m. mellifera local population belonging to M lineage in 49 districts of Ural and Volga region in comparison with southern subspecies of A. m. caucasica and A. m. carpatica local populations. The genetic research were carried out using 9 microsatellite loci Ap243, 4a110, A24, A8, A43, A113, A88, Ap049 and A28 of nuclear DNA and COI-COII loci of mtDNA. Five remaining reserves of the dark European bees A. m. mellifera were have been identified in the Ural and Volga region: burzyanskaya (mountain-forest zone of the Republic of Bashkortostan), tatyshlinskaya (Northern Republic of Bashkortostan), yuzhno-prikamskaya (Southern and Central Permskii krai), visherskaya (Northern Permskii krai), kambarskaya (Southern and Central Republic of Udmurtiya).
  177. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Analysis of the nucleotide polymorphism of the gene vitellogenin exon 4 and exon 5 of the honey bees of lineage C (A.m. caucasica, A.m. carpatica) in Russia. GenBank. 2016. Accession numbers KU146538-KU146557 (http://www.ncbi.nlm.nih.gov).
The nucleotide sequences of the gene vitellogenin exon 4 and exon 5 of the honey bees of lineage C (A.m. caucasica, A.m. carpatica) in Russia. 
  176. Ilyasov R.A., Poskryakov A.V., Petukhov A.V., Nikolenko A.G. New approach to the mitotype classification in Black honeybee Apis mellifera mellifera and Iberian honeybee Apis mellifera iberiensis. Russian Journal of Genetics, 2016, V. 52, No. 3, P. 281-291.(IF 0.446). DOI: 10.1134/S1022795416020058.
The black honeybee Apis mellifera mellifera L. is today the only subspecies of honeybee which is suitable for commercial breeding in the climatic conditions of Northern Europe with long cold winters. The main problem of the black honeybee in Russia and European countries is the preservation of the indigenous gene pool purity, which is lost as a result of hybridization with subspecies, A. m. caucasica, A. m. carnica, A. m. carpatica, and A. m. armeniaca, introduced from southern regions. Genetic identification of the subspecies will reduce the extent of hybridization and provide the gene pool conservation of the black honeybee. Modern classification of the honeybee mitotypes is mainly based on the combined use of the DraI restriction endonuclease recognition site polymorphism and sequence polymorphism of the mtDNA COI-COII region. We performed a comparative analysis of the mtDNA COI-COII region sequence polymorphism in the honey bees of the evolutionary lineage M from Ural and West European populations of black honeybee A. m. mellifera and Spanish bee A. m. iberiensis. A new approach to the classification of the honeybee M mitotypes was suggested. Using this approach and on the basis of the seven most informative SNPs of the mtDNA COI-COII region, eight honeybee mitotype groups were identified. In addition, it is suggested that this approach will simplify the previously proposed complicated mitotype classification and will make it possible to assess the level of the mitotype diversity and to identify the mitotypes that are the most valuable for the honeybee breeding and rearing.
  175. Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Новый подход к классификации митотипов темной лесной пчелы Аpis mellifera mellifera и иберийской пчелы Аpis mellifera iberiensis. Генетика. 2016. Т. 52. № 3. С. 320-331. (IF 0.446). DOI: 10.7868/S0016675816020053.
Темная лесная пчела Apis mellifera mellifera L. является на сегодняшний день единственным подвидом медоносной пчелы, который пригоден для разведения в климатических условиях Северной Европы с продолжительными холодными зимами. Основная проблема темной лесной пчелы в России и странах Европы - сохранение чистоты аборигенного генофонда, которая теряется в результате скрещивания с интродуцируемыми из южных регионов подвидами A. m. caucasica, A. m. carnica, A. m. carpatica и A. m. armeniaca. Генетическая идентификация подвидов позволит сократить масштабы гибридизации и сохранить генофонд темной лесной пчелы. Современная классификация митотипов медоносной пчелы преимущественно основана на совместном использовании полиморфизма сайтов рестрикции эндонуклеазы DraI и полиморфизма нуклеотидной последовательности локуса COI_COII мтДНК. Нами был проведен сравнительный анализ полиморфизма нуклеотидной последовательности локуса COI_COII мтДНК представителей пчел эволюционной ветви М уральской и зарубежных европейских популяций темной лесной пчелы А. m. mellifera, а также иберийской пчелы А. m. iberiensis. Предложен новый подход к классификации митотипов пчел эволюционной ветви М, который позволил выделить 8 групп на основе 7 наиболее информативных однонуклеотидных замен (SNP) локуса COI_COII мтДНК. Данный подход позволит упростить предложенную ранее сложную классификацию митотипов, оценить уровень митотипического разнообразия, выявить митотипы, наиболее ценные для селекции и разведения.
  174. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Информативность митохондриальных генов медоносной пчелы. Пчеловодство. 2016. № 4. С. 20-23.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Информативность митохондриальных генов медоносной пчелы. Пчеловодство. 2016. № 4. С. 20-23.
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. The informativeness of the mitochondrial genes of the honey bee Apis mellifera. Russian Journal of Beekeeping “Pchelovodstvo”. 2016. V. 4. P. 20-23.
Анализ SNP 12 генов митохондриального генома медоносной пчелы позволил выделить 7 информативных генов, способных дифференцировать подвиды пчел эволюционных ветвей А, М, С, О. Сравнительный анализ нуклеотидной последовательности гена ND2 мтДНК 117 образцов пчел 20 подвидов подтвердил его высокую информативность при дифференциации пчел четырех эволюционных ветвей.
The SNP analysis of the 12 genes mitochondrial genome honey bee allow to find 7 informative genes which capable to differentiating subspecies from evolutionary lineages А, М, С, О. A comparative analysis of the nucleotide sequence the gene ND2 mtDNA of 117 samples honey bees of 20 subspecies confirmed his highly informative for differentiating the bees from four evolutionary lineages..
  173. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Глава: Генетическая структура популяции темной лесной пчелы А. m. mellifera Урала и Поволжья. В книге: Роль генетического ресурса медоносных пчел среднерусской породы в продовольственной и экологической безопасности России. - Киров: НИИСХ Северо-Востока, 2016. С. 99-102. 
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Глава: Генетическая структура популяции темной лесной пчелы А. m. mellifera Урала и Поволжья. В книге: Роль генетического ресурса медоносных пчел среднерусской породы в продовольственной и экологической безопасности России. - Киров: НИИСХ Северо-Востока, 2016. С. 99-102. ISBN 978-5-7352-0143-4. 164 с. (Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. The genetic structure of the population of the dark European honey bees A. m. mellifera in the Urals and the Volga region. In: The role of the genetic resources of the dark European honey bees in the safety of food and environmental of the Russia. - Kirov: Agricultural Research Institute of the Northeast, 2016. P. 99-102. ISBN 978-5-7352-0143-4. 164 p.)
В исследовании были использованы образцы рабочих пчел из 3123 семей с 493 пасек 49 районов Южного и Среднего Урала и Поволжья, 3 районов Северного Кавказа и Восточных Карпат, использованных для сравнения в качестве маркера генофонда популяций южных пчел (А. т. caucasica, А. m. carpatica).
Исследование проводилось с целью изучения локальных популяций пчел Урала и Поволжья, оценки их основных генетических характеристик, анализа уровня интрогрессии и локализация географических границ сохранившихся резерватов темной лесной пчелы на основе полиморфизма 9 микросателлитных локусов ядерной ДНК и локуса C01-C0II мтДНК.
В результате проведенного популяционно-генетического исследования на основе полиморфизма 9 микросателлитных локусов ядерной ДНК и 1 локуса митохондриальной ДНК было показано сохранение 16 локальных популяций темной лесной пчелы A.m.mellifera. Рассчитанные нами генетические показатели - гетерозиготность, коэффициенты инбридинга и генетического родства для этих популяций будут полезны для последующих исследований.
The study used samples of worker bees from 3123 families with 493 apiaries in 49 districts of the Southern and Middle Urals and the Volga region, 3 areas of the North Caucasus and the Eastern Carpathians, used for comparison as a marker gene pool of the southern populations of bees (A. m. Caucasica, A. m. carpatica).
The study was conducted to investigate the local populations of bees of the Urals and the Volga region, assessing their main genetic characteristics, analysis of introgression level and localization of the geographical boundaries of the remaining reserves of dark forest bee-based polymorphism 9 microsatellite loci and the nuclear DNA loci C01-C0II mtDNA.
As a result of population-genetic studies based on 9 microsatellite loci polymorphism of nuclear DNA and mitochondrial DNA locus 1 has been shown to save 16 local populations A.m.mellifera dark forest bees. The calculated genetic indicators - heterozygosity coefficients of inbreeding and genetic relationship of these populations will be useful for further researches.
  172. Ильясов Р.А., Косарев М.Н., Поскряков А.В., Шарипов А.Я., Николенко А.Г. Оценка генетического потенциала темной лесной пчелы. Пчеловодство. 2016. №2. С. 20-24. (Ilyasov R.A., Kosarev M.N., Poskryakov A.V., Sharipov A. Y., Nikolenko A.G. The assessment of genetic potential of colonies of dark european bees. Russian Journal of Beekeeping. 2016. V. 2. P. 20-24.).
По результатам анализа уровня интрогрессии и оценки уровня средней гетерозиготности, определенного по данным полиморфизма девяти микросателлитных локусов, показана возможность выявления пчелиных семей с оптимальным генетическим потенциалом. Генетический потенциал пчел, обитающих в естественных и искусственных дуплах (бортях и колодах) в дикой природе, поддерживается эффективнее по сравнению с семьями, разводимыми на пасеках.
We have shown the ability to identify bee colonies with the best genetic potential. We found that the genetic potential of bee colonies, nesting in in natural and artificial tree trunks (bort and koloda) and inhabiting in the wild nature, maintain more effective than colonies in commercial beehives on apiaries using the analysis of the level of introgression of southern genes and assess the level of average heterozygosity according based on polymorphism of 9 microsatellite loci. Keywords: Apis mellifera mellifera, dark European bee, tree hollow nesting dark bee, Burzian ecotype of European bee, genetic diversity of bee colonies, the introgression of southern genes, the optimal genetic potential of bee colonies, the preservation of the genetic diversity, hybridization of subspecies.
  171. Ilyasov R.A., Farkhutdinov R.G. Chapter 2. Herbal Dietary Supplement with Antifungal Effect for Increasing the Productivity of Honey Bee Colonies. In: Honeybees: biology, behavior and benefits, Editor: Daniaele Dreesen. Hauppauge, New York: Nova Science Publishers, Inc., 2016. P. 15-22. ISBN: 978-1-63484-051-4 (e-book edition). ISBN: 978-1-63484-037-8 (hardcopy edition). 149 pp.
The advantages of using for feeding the honey bees by sugar syrup with ethanol extract from 15 medicinal plants were presented in the article. This extract has immunomodulatory effect on honey bees and has antifungal activity against pathogenic fungus Ascosphaera apis. Feeding by sugar syrup with the extract was led to a stability of wintering, was increased a productivity of honey and eggs in comparison with the control group. Antifungal activity of the extract against ascosphaerosis was similar with activity of the nystatin. Immunomodulatory effect of the extract on honey bees was similar with effect of Rhodiola rosea.
  170. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Chapter 1. The Genetic Structure of Dark European Honey Bee Population in the Ural. In: Honeybees: biology, behavior and benefits, Editor: Daniaele Dreesen. Hauppauge, New York: Nova Science Publishers, Inc., 2016. P. 1-13. ISBN: 978-1-63484-051-4 (e-book edition). ISBN: 978-1-63484-037-8 (hardcopy edition). 149 pp.
The beekeepers in Russia and Europe have been introducing bees from the southern regions to the northern ones for the last two centuries. Eventually the genetic pool of the dark European bee subspecies Apis mellifera mellifera L. was extensive hybridized. We analyzed the polymorphism of the mitochondrial (mtDNA COI–COII intergenic locus) and nuclear (two microsatellite loci, ap243 and 4a110) DNA markers in order to prove the preservation of the native bee population in the Urals, in the Republic of Bashkortostan, and the Perm Krai. Four local populations of the dark European honey bee A.m.mellifera surviving in the Urals have been identified and their principal genetic characteristics have been determined. The data of the genetic structure and geographical localization of the area of the dark European bee local populations in the Urals may be used in the restoring the damaged genetic pool of A.m.mellifera in Russia and other northern countries.
  169. Ильясов Р.А., Поскряков А.В., Салтыкова Е.С., Николенко А.Г. Глава 5.12. Диагностика темной лесной пчелы башкирской популяции на основе полиморфизма гена вителлогенина Vg. В книге: Темная лесная пчела Apis mellifera mellifera L. Республики Башкортостан / отв. ред. Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина. – Уфа: Гилем, Башкирская энциклопедия, 2015. С. 265-274. ISBN: 978-5-88185-264-1. 308 с. (Ilyasov R.A., Poskryakov A.V., Saltykova E.S., Nikolenko A.G. Chapter 5.12. Identification of dark forest bees of the Bashkir population, based on vitellogenin gene (Vg) polymorphism. In: Dark forest bee Apis mellifera mellifera L. of the Republic of Bashkortostan. Eds. R.A. Ilyasov, A.G. Nikolenko, N.M. Saifullina. - Ufa: Gilem, Bashkirskaya encilopedia, 2015. 265-274 pp. ISBN: 978-5-88185-264-1. 308 p.).
Сравнительный анализ нуклеотидной последовательности гена вителлогенина Vg может быть полезен в филогенетических реконструкциях представителей вида A.mellifera, а обнаруженные 26 позиций SNP могут использоваться в качестве генетических маркеров, дифференцирующих пчел эволюционных ветвей М и С, в селекции чистых линий A.m.mellifera, в проведении генетического штрихкодирования и создании генетического паспорта семей.
Comparative analysis of the nucleotide sequence of the gene vitellogenin Vg may be useful in phylogenetic reconstructions of a species A.mellifera, and found 26 products SNP can be used as genetic markers, differentiating bee evolutionary branches of M and C, in the selection of pure lines A.m.mellifera, to conduct genetic barcoding and the creation of a genetic passport families.
  168. Ильясов Р.А., Поскряков А.В.,Петухов А.В., Николенко А.Г. Глава 5.11. Генетическая дифференциация уральской популяции темной лесной пчелы. В книге: Темная лесная пчела Apis mellifera mellifera L. Республики Башкортостан / отв. ред. Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина. – Уфа: Гилем, Башкирская энциклопедия, 2015. С. 255-265. ISBN: 978-5-88185-264-1. 308 с. (Ilyasov R.A., Poskryakov A.V., Petukhov A.V., Nikolenko A.G. Chapter 5.11. Genetic differentiation of the Ural population of the dark forest bees. In: Dark forest bee Apis mellifera mellifera L. of the Republic of Bashkortostan. Eds. R.A. Ilyasov, A.G. Nikolenko, N.M. Saifullina. - Ufa: Gilem, Bashkirskaya encilopedia, 2015. 255-265 pp. ISBN: 978-5-88185-264-1. 308 p.).
В результате проведенных генетических исследований на основе анализа локусов митохондриальной ДНК (COI-COII мтДНК) и ядерной ДНК (два микросателлитных локуса ap243 и 4a110) популяции темной лесной пчелы A.m.mellifera на територии Урала - Республика Башкортостан (Южный Урал) и Пермский край (Средний Урал) - нами были обнаружены четыре островка сохранившейся популяции темной лесной пчелы: Вишерская, Южно-Прикамская, Татышлинская и Бурзянская. Мы надеемся, что данные, полученные в статье, позволят выполнить новые проекты по поиску новых локализаций сохранившейся популяции темной лесной пчелы A.m.mellifera в России и других странах. В дальнейшем мы планируем расширить число анализируемых локусов и территорию исследований.
As a result of genetic research based on analysis of mitochondrial DNA loci (COI-COII mtDNA) and nuclear DNA (two microsatellite loci and ap243 4a110) dark forest bee populations A.m.mellifera on the territory of the Urals - the Republic of Bashkortostan (South Urals) and the Perm region (the Middle Urals ) - we found four remaining population of the island dark forest bees: Visherskaya, South Prikamskaya, Tatyshlinskaya and Burzyan. We hope that the data obtained in this article will help to fulfill new projects to find new locations remaining population of dark forest bees A.m.mellifera in Russia and other countries. In the future we plan to expand the number of analyzed loci and area studies.
  167. Ильясов Р.А., Шареева З.В., Николенко А.Г. Глава 5.10. Генетическая структура северной башкирской популяции темной лесной пчелы. В книге: Темная лесная пчела Apis mellifera mellifera L. Республики Башкортостан / отв. ред. Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина. – Уфа: Гилем, Башкирская энциклопедия, 2015. С. 243-255. ISBN: 978-5-88185-264-1. 308 с. (Ilyasov R.A., Shareeva Z.V., Nikolenko A.G. Chapter 5.10. Genetic structure of of northern population of native dark forest bees. In: Dark forest bee Apis mellifera mellifera L. of the Republic of Bashkortostan. Eds. R.A. Ilyasov, A.G. Nikolenko, N.M. Saifullina. - Ufa: Gilem, Bashkirskaya encilopedia, 2015. 243-255 pp. ISBN: 978-5-88185-264-1. 308 p.).
Популяция северного ареала башкирской пчелы A.m.mellifera характеризуется устойчивым соотношением внутри- и межгрупповой компонент генного разнообразия, что отражает баланс процессов интеграции и дифференциации видового генофонда. Данное равновесное соотношение может сохраняться только при стабильных значениях популяционных характеристик (F-коэффициенты и гетерозиготность) на исторически сложившемся оптимальном уровне.
Анализ структуры популяции медоносной пчелы северного ареала Республики Башкортостан по морфометрическим данным показал наличие 79% пасек с содержанием семей А.m.mellifera и 21% - с присутствием гибридных пчелиных семей.
Кластерный анализ по данным морфометрических исследований экстерьерных признаков позволил отнести популяцию медоносной пчелы северного ареала Республики Башкортостан (Бирский, Мишкинский, Караидельский районы) к подвиду A.m.mellifera.
The population of the northern area of ​​the Bashkir bee A.m.mellifera characterized by steady ratio of intra- and inter-group component of genetic diversity, which reflects the balance of the processes of integration and differentiation of species gene pool. This equilibrium relationship can only be maintained with stable values ​​of population characteristics (F-ratios and heterozygosity) on historical optimum level.
Analysis of the structure of the honey bee population of the northern area of ​​the Republic of Bashkortostan morphometry showed the presence of 79% of apiaries containing A.m.mellifera families and 21% - with the presence of hybrid bee colonies.
Cluster analysis according to morphometric studies exterior signs allowed to carry the honey bee population of the northern area of ​​the Republic of Bashkortostan (Birsky, Mishkinskoye, Karaidelsky District) to the subspecies A.m.mellifera.
  166. Николенко А.Г., Ильясов Р.А., Поскряков А.В. Глава 5.6. Ареал бурзянской популяции темной лесной пчелы. В книге: Темная лесная пчела Apis mellifera mellifera L. Республики Башкортостан / отв. ред. Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина. – Уфа: Гилем, Башкирская энциклопедия, 2015. С. 218-227. ISBN: 978-5-88185-264-1. 308 с. (Nikolenko A.G., Ilyasov R.A., Poskryakov A.V. Chapter 5.6. The area of distribution of Burzyan dark forest bees. In: Dark forest bee Apis mellifera mellifera L. of the Republic of Bashkortostan. Eds. R.A. Ilyasov, A.G. Nikolenko, N.M. Saifullina. - Ufa: Gilem, Bashkirskaya encilopedia, 2015. 218-227 pp. ISBN: 978-5-88185-264-1. 308 p.).
Показано генетическое родство (разной степени) бортевых пчел с пасечными пчелиными семьями в пределах ареала популяции. Генетические процессы между ними требуют отдельного обсуждения. Генетическая уникальность как бортевой, так и бурзянской популяции в целом предполагалась многими авторами, однако нам впервые удалось показать на подробном экспериментальном материале генетическую дифференциацию бурзянской популяции от большинства популяций Урала и Поволжья.
Полученные результаты позволяют предполагать существование двойной генетической границы ареала, которая должна быть присуща естественной (длительно существующей) популяции медоносной пчелы в силу биологических особенностей вида: радиус удаления от семьи матки и трутней во время спаривания может достигать 12 км, дальность полета пчелиного роя - 40 км и более. Впрочем, двойная генетическая граница должна быть свойственна и популяциям многих видов с протяженным сплошным ареалом.
Показано существование естественного интенсивного трутневого фона - третьего (не по значимости) механизма, определяющего генетическую стабильность естественной популяции, помимо изоляции и социального фактора, известных ранее: активное ядро генофонда популяции формирует краевые зоны, которые, в свою очередь, защищают это ядро. Таким образом, помимо искусственных технологий - популяции закрытого типа и принципа двойной замены маток - возможна стратегия естественного сохранения генофонда медоносной пчелы, дающая более стабильный результат.
Displaying the genetic relationship (of varying degrees) board with bee bee bee families within the range of the population. Genetic processes between them require a separate discussion. Genetic uniqueness as wild-hive and Burzyan the general population assumed by many authors, but the first time we were able to show the detailed experimental data on genetic differentiation Burzyan populations of most populations of the Volga region and the Urals.
These results suggest the existence of a double genetic boundaries of the area, which should be inherent in the natural (continuous current) population of honey bees due to the biological characteristics of species: the radius of the distance from the family of the uterus and the drones during mating can be up to 12 km range beehive - 40 km and more. However, the double border must be a genetic characteristic of many species and populations with an extended continuous habitat.
The existence of natural background of intense drone - the third (not least) the mechanism that determines the genetic stability of the natural populations, in addition to isolation and social factor, previously known: the active nucleus of the gene pool of the population forms the boundary zone, which, in turn, protect this core. Thus, apart from artificial technologies - the population of the closed type and the principle of dual replacement queens - a possible strategy of the natural preserve the gene pool of the honey bee, which gives a more stable result..
  165. Фархутдинов Р.Г., Ильясов Р.А., Юмагужин Ф.Г., Уразбахтина Н.А., Туктарова Ю.В., Шафикова В.М., Абдуллин М.Ф. Глава 4.7. Применение фитосбора для лечения аскосфероза темной лесной пчелы башкирской популяции. В книге: Темная лесная пчела Apis mellifera mellifera L. Республики Башкортостан / отв. ред. Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина. – Уфа: Гилем, Башкирская энциклопедия, 2015. С. 163-176. ISBN: 978-5-88185-264-1. 308 с. (Farkhutdinov R.G., Ilyasov R.A., Yumaguzhin F.G. , Urazbakhtina N.A., Tuktarova Y.V., Shafikova V.M., Abdullin M.F. Chapter 4.7. The use of drugs on the basis of phytoextracts (extracts of drug plants) against ascospaerosis (Ascospaera apis) in the native population of dark forest bees. In: Dark forest bee Apis mellifera mellifera L. of the Republic of Bashkortostan. Eds. R.A. Ilyasov, A.G. Nikolenko, N.M. Saifullina. - Ufa: Gilem, Bashkirskaya encilopedia, 2015. 163-176 pp. ISBN: 978-5-88185-264-1. 308 p.).
Изучены фунгицидные свойства созданного авторами растительного сбора  по отношению к Ascosphaera apis. Обсуждается возможность использования сбора в профилактике и лечение аскосфероза. В ходе проведения масс-спектрометрического анализа химического состава экстрактов растительного сбора, установлены вещества, предположительно обладающие фунгицидной активностью. На основе сравнения зон задержки роста возбудителя аскосфероза in vitro установлена фунгицидная активность  лекарственных трав и фитосбора. Обнаружено увеличение активности ферментов каталазы и пероксидазы в кишечнике и инвертазы в глоточных железах зимующих пчел под влиянием подкормки сиропа с экстрактом растительного сбора, что является показателем повышения зимостойкости пчелиных семей. В производственных опытах показано, что подкормка пчелиных семей сиропом с экстрактом растительного сбора оказывает положительное влияние на зимовку, весеннее развитие и продуктивность пчелиной семьи.
Studied the fungicidal properties of the plant collection was created by the authors with respect to Ascosphaera apis. The possibility of using the collection in the prevention and treatment of askosferoza. In the course of mass spectrometric analysis of the chemical composition of vegetable extracts collecting installed substances thought to have fungicidal activity. Based on the comparison of zones of growth inhibition in vitro pathogen askosferoza set fungicidal activity of herbs and fitosbora. An increase in the activity of catalase and peroxidase enzymes in the gut and in the pharyngeal glands of invertase wintering bees under the influence of feeding syrup with an extract of the plant collection, which is an indicator of increasing hardiness of bee colonies. The industrial experience has shown that feeding of bee colonies syrup with an extract of the plant collection has a positive effect for the winter, spring development and productivity of the bee colony.
  164. Ильясов Р.А., Косарев М.Н., Юмагужин Ф.Г. Глава 1.5. Современная популяция бурзянской бортевой темной лесной пчелы на Южном Урале. В книге: Темная лесная пчела Apis mellifera mellifera L. Республики Башкортостан / отв. ред. Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина. – Уфа: Гилем, Башкирская энциклопедия, 2015. С. 27-33. ISBN: 978-5-88185-264-1. 308 с. (Ilyasov R.A., Kosarev M.N., Yumaguzhin F.G. Chapter 1.5. The modern population of Burzyan wild-hive dark forest bees in the southern Urals. In: Dark forest bee Apis mellifera mellifera L. of the Republic of Bashkortostan. Eds. R.A. Ilyasov, A.G. Nikolenko, N.M. Saifullina. - Ufa: Gilem, Bashkirskaya encilopedia, 2015. 27-33 pp. ISBN: 978-5-88185-264-1. 308 p.).
Бурзянская бортевая темная лесная пчела A.m.mellifera представляет большой интерес для пчеловодов и ученых европейских стран, так как по ней можно сделать реконструкцию естественной истории пчел. В 2011 г. на основании заявки НИИ пчеловодства и государственного заповедника «Шульган-Таш» пчелы этой популяции выделены как селекционное достижение в отдельный породный тип «Бурзянская бортевая пчела».
Burzyan tree hollow dark forest bee A.m.mellifera of great interest to beekeepers and scholars of European countries, as it can be done on the reconstruction of the natural history of bees. In 2011, upon the request of the Research Institute of apiculture and the State Reserve "Shulgan-Tash" bee this population identified as a breeding achievement as a separate breed type "Burzyan wild-hive bee.".
  163. Ильясов Р. А., Николенко А. Г., Сайфуллина Н. М. Темная лесная пчела Apis mellifera mellifera L. Республики Башкортостан / отв. ред. Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина. – Уфа: Гилем, Башкирская энциклопедия, 2015. – 308 с. ISBN: 978-5-88185-264-1. (Ilyasov R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis mellifera mellifera L. of the Republic of Bashkortostan. Eds. R.A. Ilyasov, A.G. Nikolenko, N.M. Saifullina. - Ufa: Gilem, Bashkirskaya encilopedia, 2015. - 308 p. ISBN: 978-5-88185-264-1.).
Коллективная монография представляет собой собрание теоретических и экспериментальных работ сотрудников научных центров Республики Башкортостан, занимающихся решением задач по сохранению генофонда башкирской популяции темной лесной пчелы. Для преподавателей, студентов, научных сотрудников, пчеловодов в качестве учебно-методического пособия, научно-практического руководства и справочника в области пчеловодства.
The collective monograph is a collection of theoretical and experimental studies of scientists of different scientifi c centers of the Republic of Bashkortostan involved in problems of gene pool preservation of the dark forest bee of Bashkir population. It is recommended for teachers, students, researchers, beekeepers as scientific and practical manual, guide and reference book in the field of beekeeping.
  162. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Анализ информативности митохондриальных генов в филогенетических исследованиях медоносной пчелы Apis mellifera. Биомика. Т. 7. № 3. 2015. С. 192-205.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Анализ информативности митохондриальных генов в филогенетических исследованиях медоносной пчелы Apis mellifera. Биомика. Т. 7. № 3. 2015. С. 192-205.
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Analisys of the informativeness of the mitochondrial genes in phylogenetics researches of the honey bee Apis mellifera. Biomics. V. 7 (3). 2015. P. 192-205.
Проведен сравнительный анализ нуклеотидной последовательности 12 генов митохондриального генома медоносной пчелы, на основании которого удалось выделить 7 информативных генов, позволяющих дифференцировать подвиды пчел эволюционных ветвей А, М, С, О. На примере использования сравнительного анализа нуклеотидной последовательности гена ND2 мтДНК на статистически значимом объеме выборки мы показали высокий уровень дифференцирующей способности этого гена и предположили возможность отдельного использования каждого из 7 генов для дифференциации подвидов 4 эволюционных ветвей.
Seven informative genes of the honey bee Apis mellifera, which allow differentiating subspecies from evolutionary lineages А, М, С, О, were found based on the comparative analysis of 12 genes mitochondrial genome. We had showed the high level differentiate ability of the gene ND2 mtDNA by comparative analysis of the sequences this gene on statistically significant size of sample of the honey bees. We suggested that each one from the seven informative genes can be used for differentiation the subspecies of the honey bees from evolutionary lineages А, М, С, О.
  161. Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Aнализ состояния генофонда современной популяции темной лесной пчелы A. m. mellifera Урала и Поволжья. Биомика. Т. 7. № 3. 2015. С. 167-191.
Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Aнализ состояния генофонда современной популяции темной лесной пчелы A. m. mellifera Урала и Поволжья. Биомика. Т. 7. № 3. 2015. С. 167-191.
Ilyasov R.A., Poskryakov A.V., Petukhov A.V., Nikolenko A.G. The gene pool analisys of the current population of the dark European honey bee A. m. mellifera in the Ural and Volga region. Biomics. V. 7 (3). 2015. P. 167-191.
Нами было проведено молекулярно-генетическое исследование локальных популяций темной лесной пчелы A. m. mellifera эволюционной ветви М 49 районов Урала и Поволжья в сравнении с локальными популяциями пчел южных подвидов A. m. caucasica и A. m. carpatica эволюционной ветви С 3 районов Северного Кавказа и Восточных Карпат на основе анализа полиморфизма 9 микросателлитных локусов Ap243, 4a110, A24, A8, A43, A113, A88, Ap049 и A28 ядерной ДНК и локуса COI-COII мтДНК. Мы обнаружили на территории 16 районов Урала и Поволжья сохранившиеся резерваты аборигенной темной лесной пчелы A. m. mellifera с гибридизацией менее 5%. В популяциях пчел на территории 8 районов Урала и Поволжья наблюдалась умеренная гибридизация до 20%. На территории Урала и Поволжья нами выделены 5 сохранившихся резерватов (популяций) темной лесной пчелы A. m. mellifera: бурзянская (горно-лесная зона Республики Башкортостан), татышлинская (Север Республики Башкортостан), южно-прикамская (Юг и Центр Пермского края), вишерская (Север Пермского края), камбарская (Юг и Центр Республики Удмуртия). Эти пять популяций составляют основу генофонда темной лесной пчелы Урала и Поволжья. Основной массив сохранившегося аборигенного генофонда A. m. mellifera (ядро генофонда популяции A. m. mellifera) располагается на территории всего Пермского края и Севера Республики Башкортостан. Для популяции пчел A. m. mellifera Урала и Поволжья были рассчитаны средние значения гетерозиготности (Hо = 0,340 ± 0,037, Hs = 0,357 ± 0,032, Ht = 0,421 ± 0,037), коэффициенты инбридинга (Fis = 0,081 ± 0,037, Fit = 0,196 ± 0,042, Fst = 0,125 ± 0,023), коэффициенты родства (R = 0,210 ± 0,034). Данные генетические стандарты популяции темной лесной пчелы A. m. mellifera Урала и Поволжья будут полезны для последующих популяционных исследований медоносной пчелы в России и Европе.
We have carried out the molecular genetic research of the dark European bee A. m. mellifera local population belonging to M lineage in 49 districts of Ural and Volga region in comparison with southern subspecies of A. m. caucasica and A. m. carpatica local populations belonging to C lineage in 3 districts of Northern Caucasus and Carpathians region. The genetic research were carried out using 9 microsatellite loci Ap243, 4a110, A24, A8, A43, A113, A88, Ap049 and A28 of nuclear DNA and COI-COII loci of mtDNA. We have discovered low level less to 5% introgression populations of the dark European bee A. m. mellifera in 16 districts of Ural and Volga region. Introgression to 20% was discovered in populations of the dark European bee A. m. mellifera in 8 districts of Ural and Volga region. Five remaining reserves of the dark European bees A. m. mellifera were have been identified in the Ural and Volga region: burzyanskaya (mountain-forest zone of the Republic of Bashkortostan), tatyshlinskaya (Northern Republic of Bashkortostan), yuzhno-prikamskaya (Southern and Central Permskii krai), visherskaya (Northern Permskii krai), kambarskaya (Southern and Central Republic of Udmurtiya). These five populations have formed the basis of the gene pool of the dark European bee A. m. mellifera in the Ural and Volga region. The bulk of the surviving indigenous gene pool of the dark European bee A. m. mellifera (the core of the gene pool of the population A. m. mellifera) predominantly located in the Permskii krai and the Republic of Bashkortostan. We have calculated the average heterozygosity (Hо = 0,340 ± 0,037, Hs = 0,357 ± 0,032, Ht = 0,421 ± 0,037), coefficients of inbreeding (Fis = 0,081 ± 0,037, Fit = 0,196 ± 0,042, Fst = 0,125 ± 0,023) and coefficient of relatedness (R = 0,210 ± 0,034) for the population of the dark European bee A. m. mellifera of the Ural and Volga region. These genetic standards of the dark European bee A. m. mellifera of the Ural and Volga region will be useful for following population researches in Russia and Europe.
  160. Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Новый подход к классификации митотипов темной лесной пчелы аpis mellifera mellifera и иберийской пчелы аpis mellifera iberiensis. Генетика. 2016. Т. 52. № 2. С. 1–12. (IF 0.446). DOI:10.7868/S0016675816020053.

Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Новый подход к классификации митотипов темной лесной пчелы аpis mellifera mellifera и иберийской пчелы аpis mellifera iberiensis. Генетика. 2016. Т. 52. № 2. С. 1–12. (IF 0.446). DOI:10.7868/S0016675816020053

Ilyasov R.A., Poskryakov A.V., Petukhov A.V., Nikolenko A.G. A new approach to the classification of mitotypes of dark European bees Apis mellifera mellifera and Iberian bees Apis mellifera iberiensis. Russian journal of genetics. 2016. V. 52 (2). P. 1–12. (IF 0.446). DOI: 10.7868/S0016675816020053.

Темная лесная пчела Apis mellifera mellifera L. является на сегодняшний день единственным подвидом медоносной пчелы, который пригоден для разведения в климатических условиях Северной Европы с продолжительными холодными зимами. Основная проблема темной лесной пчелы в России и странах Европы – сохранение чистоты аборигенного генофонда, которая теряется в результате скрещивания с интродуцируемыми из южных регионов подвидами A. m. caucasica, A. m. carnica, A. m. carpatica и A. m. armeniaca. Генетическая идентификация подвидов позволит сократить масштабы гибридизации и сохранить генофонд темной лесной пчелы. Современная классификация митотипов медоносной пчелы преимущественно основана на совместном использовании полиморфизма сайтов рестрикции эндонуклеазы DraI и полиморфизма нуклеотидной последовательности локуса COI COII мтДНК. Нами был проведен сравнительный анализ полиморфизма нуклеотидной последовательности локуса COI COII мтДНК представителей пчел эволюционной ветви М уральской и зарубежных европейских популяций темной лесной пчелы А. m. mellifera, а также иберийской пчелы А. m. iberiensis. Предложен новый подход к классификации митотипов пчел эволюционной ветви М, который позволил выделить 8 групп на основе 7 наиболее информативных однонуклеотидных замен (SNP) локуса COI COII мтДНК. Данный подход позволит упростить предложенную ранее сложную классификацию митотипов, оценить уровень митотипического разнообразия, выявить митотипы, наиболее ценные для селекции и разведения.

The article provides a comparative analysis of the nucleotide sequence polymorphism of loci COI- COII mtDNA representatives bee evolutionary lineage M of Ural and foreign European populations of dark European bees A. m. mellifera, and the Iberian bees A. m. iberiensis. We have proposed a new mitotypic classification of dark European bees and Iberian bees of evolutionary lineage M, based on an analysis of eight of the most informative SNP. This classification will allow to estimate the level of mitotypic diversity of the whole population of dark European and the Iberian bees, to preserve and maintain the level of mitotypic diversity, to recognize most important mitotypes for the selection and breeding.
.
  159. Фархутдинов Р.Г., Ильясов Р.А., Уразбахтина Н.А., Туктарова Ю.В., Шафикова В.М., Абдуллин М.Ф. Определение и стандартизация биологически активных веществ биологического стимулятора продуктивности пчелиной семьи с фунгицидной активностью. Материалы Всероссийской научно-практической конференции с международным участием "Инновационные технологии в пчеловодстве и проблемы сохранения генофонда медоносных пчел". 22 апреля 2015. Уфа: БГАУ. 2015. С. 190-195. (R.G.Farkhutdinov, R.A. Ilyasov, N.A. Urazbakhtina, Y.V. Tuktarova, V.M. Shafikova, M.F. Abdullin DEFINING AND STANDARDIZING BIOLOGICALLY ACTIVE SUBSTANCES BIOLOGICAL STIMULATOR PRODUCTIVITY OF BEE FAMILY FUNGICIDAL ACTIVITY. Proceedings of the russian international conference "Innovation technology in beekeeping and problem of saving the gene pool". 22 april 2015. Ufa. P. 190-195.).
Аннотация: Аскосфероз – инфекционная болезнь пчелиной семьи, вызываемая
паразитическим грибком Ascosphaera apis. Аскосфероз подавляет развитие
пчелиной семьи и может привести к гибели при отсутствии лечения и
стимуляции иммунитета. Химические препараты с фунгицидным действием
очень эффективны в борьбе с аскосферозом, но обладают побочными
действиями. В данной статье мы описали препарат «Фитоаск»,
представляющий собой спиртовый экстракт растительного сбора, обладающий
одновременно фунгицидным и стимулирующим эффектом для пчелиной семьи.
Применение этого препарата может повысить продуктивность пчелиной семьи
и снизить затраты на ее содержание.
Ключевые слова: Apis mellifera mellifera, Ascosphaera apis, аскосфероз,
медоносная пчела, фунгицид, «Фитоаск».
Abstract: Ascosphaerosis - infectious disease of bees caused by a parasitic fungus
Ascosphaera apis. Ascosphaerosis suppresses the development of bee colonies and
can lead to death if untreated and stimulation of immunity. Chemicals with fungicidal
action are very effective in combating аscosphaerosis, but they have side effects. In
this article we describe the drug «Fitoask», which is a collection of alcoholic extract
of plant that has both fungicidal and stimulating effect for the bee colony. Its use can
increase the productivity of the bee families and reduce the cost of its maintenance.
Keywords: Apis mellifera mellifera, Ascosphaera apis, аscosphaerosis, honey bee, a
fungicide, «Fitoask». 
  158. Ilyasov R.A., Kosarev M.N., Neal A., Yumaguzhin F.G. Dunkle bienen im sudlichen Ural. Deutsches Bienen Journal. 2015. V. 9. P. 48-51.
Бурзянская бортевая пчела и бортевое пчеловодство на Южном Урале (Burzyan wild-hive honeybee and wild-hive beekeeping in South Ural)
A spontaneous hybridization among honeybees in most European countries has led to the loss in the gene pool of the dark European honeybee. We believe Russia still has a considerable array of purebred populations of European dark bees A. m. mellifera. The commonest bee, the Burzyan Honey Bee, live under protection in the mountain forest zone of South Ural in the State Nature Biosphere Reserve «Shulgan-Tash», regional nature reserve «Altyn Solok» and National Park «Bashkortostan». These Wild Tree Hollow Honeybees are of great interest among beekeepers and scientists around the world, as they could be used to make a reconstruction of the natural history of bees.
На современном этапе развития пчеловодства в Евразии, на фоне массовой гибридизации подвидов пчел и потери генофонда темной лесной (среднеевропейской) пчелы в большинстве стран Европы, Россия располагает значительными массивами чистопородных популяций темной лесной пчелы A. m. mellifera. Наиболее известная популяция – бурзянская бортевая пчела – сохраняется в условиях бортевого пчеловодства, дикого обитания и пасек с рамочными ульями в горно-лесной зоне Южного Урала на территории государственного природного биосферного заповедника «Шульган-Таш», регионального природного заказника «Алтын Солок» и национального парка «Башкирия». Дикие и бортевые пчелы представляют большой интерес для пчеловодов и ученых всего мира, так как по ним можно сделать реконструкцию естественной истории пчел.
Die Verkreuzung von Rassen der Honigbiene hat in den meisten europäischen Ländern zu einer Verarmung des Genpools der Dunklen Europäischen Biene Apis mellifera mellifera geführt. Wir glauben, dass es in Russland noch immer reine Populationen dieser Bienenrasse gibt. Die hier häufigste Dunkle Biene, die Burzyanische Biene, ist in den Waldregionen des südlichen Ural in mehreren Reservaten unter Schutz gestellt.Diese in Baumhöhlen nistenden Bienen sind für die Erforschung der Naturgeschichte der Honigbienen von besonderem Interesse.
Ilyasov R.A., Kosarev M.N., Neal A., Yumaguzhin F.G. Dunkle bienen im sudlichen Ural. Deutsches Bienen Journal. 2015. V. 9. P. 48-51.
  157. Ильясов Р.А., Косарев М.Н., Поскряков А.В., Шарипов А.Я., Николенко А.Г. Новый подход к оценке генетического потенциала семей темной лесной пчелы Apis mellifera mellifera на основе полиморфизма микросателлитных локусов. Биомика. 2015. Т. 7. № 2. C. 138-152.
Ильясов Р.А., Косарев М.Н., Поскряков А.В., Шарипов А.Я., Николенко А.Г. Новый подход к оценке генетического потенциала семей темной лесной пчелы Apis mellifera mellifera на основе полиморфизма микросателлитных локусов. Биомика. 2015. Т. 7. № 2. C. 138-152.

Ilyasov R.А., Кosarev М.N., Poskryakov A.V., Sharipov A.Y., Nikolenko A.G. New approach to the assessment of genetic potential of colonies of dark European bee Apis mellifera mellifera based on polymorphism of microsatellite loci. Biomics. 2015. V. 7 (2). P. 138-152.

 В России и странах Западной и Северной Европы темная лесная пчела Apis mellifera mellifera была признана наиболее эффективной для коммерческого разведения. Ранее пчеловоды северных стран были другого мнения и ставили массовые эксперименты по интродукции и разведению подвидов из Южной и Восточной Европы на своих пасеках. Такое развитие событий привело к массовой интрогрессии генов южных пчел в популяции темной лесной пчелы и стало результатом потери чистоты аборигенного генофонда. Для восстановления генофонда темной лесной пчелы в пределах исторического ареала необходимо проводить селекцию пчелиных семей на основе генетической стандартизации в сохранившихся изолятах A.m.mellifera. По результатам анализа уровня интрогрессии южных генов и оценки уровня средней гетерозиготности по данным полиморфизма 9 микросателлитных локусов мы показали возможность идентификации пчелиных семей с оптимальным генетическим потенциалом. Мы обнаружили, что генетический потенциал пчелиных семей, обитающих в естественных и искусственных дуплах (бортях и колодах) в условиях дикой природы, поддерживается эффективнее по сравнению с семьями, разводимыми в ульях на пасеках.

In Russia and the countries of Western and Northern Europe dark European bee Apis mellifera mellifera has been recognized as the most effective for commercial breeding. Earlier beekeepers of Nordic countries were of a different opinion and put massive experiments on the introduction and breeding subspecies of the Southern and Eastern Europe in their apiaries. This development led to massive introgression of genes of bees from southern populations into dark European bees. Therefore they lost of the purity of the aboriginal gene pool. For restore the gene pool of the dark European bees within the historic range is necessary selection of colonies based on the genetic standardization in the preserved isolates of A.m.mellifera. We have shown the ability to identify bee colonies with the best genetic potential. We found that the genetic potential of bee colonies, nesting in natural and artificial tree trunks (bort and koloda) and inhabiting in the wild nature, maintain more effective than colonies in commercial beehives on apiaries using the analysis of the level of introgression of southern genes and assess the level of average heterozygosity according based on polymorphism of 9 microsatellite loci.
  156. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Современное состояние и сохранение темной лесной пчелы Apis mellifera mellifera в России и странах Европы. Биомика. 2015. Т. 7. № 2. C. 121-127.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Современное состояние и сохранение темной лесной пчелы Apis mellifera mellifera в России и странах Европы. Биомика. 2015. Т. 7. № 2. C. 121-127.

Ilyasov R.А., Poskryakov A.V., Nikolenko A.G. Current status and preservation of the dark European bees Apis mellifera mellifera in Russia and Europe. Biomics. 2015. V. 7 (2). P. 121-127.

 В статье проведен анализ современного состояния популяции темной лесной пчелы A.m.mellifera в России и странах Европы. В странах Европы еще сохранились небольшие резерваты на территории ряда стран. Россия на данный момент располагает значительным резервом генофонда темной лесной пчелы A.m.mellifera. Однако генофонд подвержен все усиливающейся интрогрессии со стороны подвидов из южных регионов. В результате скрещивания с южными подвидами происходит потеря адаптированности темной лесной пчелы к местным условиям и снижение общей продуктивности. Для сохранения генофонда темной лесной пчелы уже не достаточно видимых морфометрических признаков, необходима селекция на основе анализа молекулярных ДНК маркеров с охватом ядерного и митохондриального генома. Поддержка со стороны Правительства и региональных обществ пчеловодов в создании и становлении Российской ассоциации Apis mellifera mellifera (РААММ) позволит объединить все усилия пчеловодов России по сохранению аборигенной темной лесной пчелы и перевести пчеловодство России на новый генетический уровень селекции.

The article analyzes the current status of the population of the dark European bees A.m.mellifera in Russia and Europe. In Europe, still remained small reserves in the territory of some countries. Now in Russia has a large reserve of the gene pool of a dark European bees A.m.mellifera. However, the gene pool is subject to increasing introgression from the subspecies from the southern regions, which lead dark European bees to the loss adaptation to local conditions and reduce full productivity. To preserve the gene pool of the dark European bees is not sufficiently only visible morphometric traits but necessary selection based on the analysis of molecular DNA markers, covering nuclear and mitochondrial genome. Supporting of Government and the regional beekeepers associations in the creation and development of the Russian Association of Apis mellifera mellifera (RAAMM) will integrate all the efforts of Russian beekeepers to preserve native dark European and help to transition of Russian beekeeping to a new level of genetic selection.
  155. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Современное состояние и сохранение генофонда Apis mellifera mellifera в России и странах Европы. Пчеловодство. 2016. № 1. С. 8-11.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Современное состояние и сохранение генофонда Apis mellifera mellifera в России и странах Европы. Пчеловодство. 2016. № 1. С. 8-11.
 
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Current status and preservation of gene pool of Apis mellifera mellifera in Russia and Europe. Russian Journal of Beekeeping. 2016. V. 1. P. 8-11.

The article analyzes the current status of the population of the dark European bees A.m.mellifera in Russia and Europe. In Europe, still remained small reserves in the territory of some countries. Russia still has a large reserve of the gene pool of a dark European bees A.m.mellifera. However, the gene pool is subject to increasing introgression from the subspecies from the southern regions, which lead dark European bees to the loss adaptation to local conditions and reduce full productivity. To preserve the gene pool of the dark European bees is not sufficiently only visible morphometric traits but necessary selections based on the analysis of molecular DNA markers, covering nuclear and mitochondrial genome. Supporting of Government and the regional beekeepers associations in the creation and development of the Russian Association of Apis mellifera mellifera (RAAMM) will integrate all the efforts of Russian beekeepers to preserve native dark European and help to transition of Russian beekeepin to a new level of genetic selection.

В статье проведен анализ современного состояния популяции темной лесной пчелы A.m.mellifera в России и странах Европы. В странах Европы еще сохранились небольшие резерваты на территории ряда стран. Россия еще располагает значительным резервом генофонда темной лесной пчелы A.m.mellifera. Однако генофонд подвержен все усиливающейся интрогрессии со стороны подвидов из южных регионов, которая приводят к потере адаптированности темной лесной пчелы к местным условиям и снижению общей продуктивности. Для сохранения генофонда темной лесной пчелы уже не достаточны видимых морфометрических признаков, необходима селекция на основе анализа молекулярных ДНК маркеров с охватом ядерного и митохондриального генома. Поддержка со стороны Правительства и региональных обществ пчеловодов в создании и становлении Российской ассоциации Apis mellifera mellifera (РААММ) позволит объединить все усилия пчеловодов России по сохранению аборигенной темной лесной пчелы и перевести пчеловодство России на новый генетический уровень селекции.
  154. Ильясов Р.А., Фархутдинов Р.Г., Иванов А.А., Шафикова В.М., Туктарова Ю.В., Воронков Ю.П. Состав для стимуляции развития пчелиных семей, профилактики и лечения аскосфероза. Патент России № RU 2552672. 10.06.2015. Бюл. № 16.
Предлагаемое изобретение относится к области зоотехнии. Предложенный состав содержит водно-спиртовые экстракты травы вероники, листа березы, травы лабазника, цветков календулы, хвои ели или пихты, травы эхинацеи, листьев эвкалипта, травы хвоща, цветков бессмертника, травы мелиссы, травы чабреца, коры осины, травы чистотела, слоевища исландского мха, чеснока при определенном соотношении компонентов. Использование изобретения повышает продуктивность и зимостойкость пчелиных семей за счет повышения устойчивости организма пчел к аскосферозу и увеличивает продолжительность действия препарата.

FIELD: agriculture. SUBSTANCE: composition comprises wateralcohol extracts of speedwell grass, birch leaves, meadowsweet grass, marigold flowers, fir or spruce needles, Echinacea grass, eucalyptus leaves, horsetail grass, flowers of helichrysum, balm lemon grass, thyme grass, bark of aspen, celandine grass, thallus of Iceland moss, garlic at a certain ratio of the components. EFFECT: use of the invention improves the productivity and winter hardiness of bee families by increasing the bee body resistance to ascospherosis, and increases the duration of the effect of the preparation.

Ильясов Р.А., Фархутдинов Р.Г., Иванов А.А., Шафикова В.М., Туктарова Ю.В., Воронков Ю.П. Состав для стимуляции развития пчелиных семей, профилактики и лечения аскосфероза. Патент России № RU 2552672. 10.06.2015. Бюл. № 16.

Ilyasov R.A., Farkhutdinov R.G., Ivanov A.A., Shafikova V.M., Tuktarova Yu.V., Voronkov Y.P. Composition for stimulation of development of bee families, prevention and treatment of ascospherosis. Patent of Russia № RU 2552672. 10.06.2015. Bull. № 16.
  153. Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Новая классификация митотипов локуса COI-COII мтДНК пчел эволюционной ветви М (Аpis mellifera mellifera, Аpis mellifera iberiensis). Пчеловодство. 2015. № 9. С. 22-26.
В статье проведен сравнительный анализ полиморфизма нуклеотидной последовательности локуса COI- COII мтДНК представителей пчел эволюционной ветви М уральской и зарубежных европейских популяций темной лесной пчелы А. m. mellifera, а также иберийской пчелы А. m. iberiensis. Нами предложена новая митотипическая классификация темной лесной пчелы и иберийской пчелы эволюционной ветви М, основанная на анализе 8 наиболее информативных SNP. Данная классификация позволит оценить уровень митотипического разнообразия всей популяции темной лесной и иберийской пчелы, сохранить и поддерживать уровень митотипического разнообразия, выявить митотипы, представляющие наибольшую ценность для селекции и разведения.
Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Новая классификация митотипов локуса COI-COII мтДНК пчел эволюционной ветви М (Аpis mellifera mellifera, Аpis mellifera iberiensis). Пчеловодство. 2015. № 9. С. 22-26.

The article provides a comparative analysis of the nucleotide sequence polymorphism of loci COI- COII mtDNA representatives bee evolutionary lineage M of Ural and foreign European populations of dark European bees A. m. mellifera, and the Iberian bees A. m. iberiensis. We have proposed a new mitotypic classification of dark European bees and Iberian bees of evolutionary lineage M, based on an analysis of eight of the most informative SNP. This classification will allow to estimate the level of mitotypic diversity of the whole population of dark European and the Iberian bees, to preserve and maintain the level of mitotypic diversity, to recognize most important mitotypes for the selection and breeding.
Ilyasov RA., Poskryakov A.V., Petukhov A.V., Nikolenko A.G. New mitotypic classification of mitochondrial COI-COII loci of honeybees of evolutionary lineage M (Аpis mellifera mellifera, Аpis mellifera iberiensis). Russian Journal of Beekeeping. 2015. V. 9. P. 22-26.
  152. Kaskinova M.D., Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Analysis of the Genetic Structure of Honeybee (Apis mellifera L.) Populations. Russian Journal of Genetics. 2015. V. 51 (10). P. 1033-1035. DOI: 10.1134/S1022795415100075.
Представлены результаты анализа генетической структуры популяции медоносной пчелы в южной части Башкортостана по данным мтДНК (локус COI-COII) и пяти микросателлитным локусам ядерной ДНК (Ар243, 4А110, А8, А113 и А28). Полученные данные свидетельствуют, что исследуемые популяции пчел испытывают дефицит гетерозигот, несмотря на интенсивную межпородную
гибридизацию, а также позволяют предположить локализацию в изучаемом регионе границы между популяцией Apis mellifera mellifera L. и гибридной зоной.

The genetic structure of honeybee populations from the southern part of Bashkortostan was assessed based on an analysis of mtDNA (COI–COII locus) and five nuclear DNA microsatellite loci (Ap243, 4A110, A8, A113, and A28). The data indicate that the examined populations experience a deficit of heterozygotes despite intense interpedigree hybridization. It is suggested that there is a boundary between the population of Apis mellifera mellifera L. and the hybrid zone in the examined region.

Kaskinova M.D., Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Analysis of the Genetic Structure of Honeybee (Apis mellifera L.) Populations. Russian Journal of Genetics. 2015. V. 51 (10). P. 1033-1035. (IF 0.446). DOI: 10.1134/S1022795415100075.
  151. Каскинова М.Д., Ильясов Р.А., Поскряков А.В., Николенко А.Г. Анализ генетической структуры популяций медоносной пчелы (Apis mellifera L.). Генетика. 2015. Т. 51. № 10. C. 1199-1202. (IF 0.446). DOI: 10.7868/S0016675815100070.
Представлены результаты анализа генетической структуры популяции медоносной пчелы в южной части Башкортостана по данным мтДНК (локус COI-COII) и пяти микросателлитным локусам ядерной ДНК (Ар243, 4А110, А8, А113 и А28). Полученные данные свидетельствуют, что исследуемые популяции пчел испытывают дефицит гетерозигот, несмотря на интенсивную межпородную
гибридизацию, а также позволяют предположить локализацию в изучаемом регионе границы между популяцией Apis mellifera mellifera L. и гибридной зоной.

The genetic structure of honeybee populations from the southern part of Bashkortostan was assessed based on an analysis of mtDNA (COI–COII locus) and five nuclear DNA microsatellite loci (Ap243, 4A110, A8, A113, and A28). The data indicate that the examined populations experience a deficit of heterozygotes despite intense interpedigree hybridization. It is suggested that there is a boundary between the population of Apis mellifera mellifera L. and the hybrid zone in the examined region.

Каскинова М.Д., Ильясов Р.А., Поскряков А.В., Николенко А.Г. Анализ генетической структуры популяций медоносной пчелы (Apis mellifera L.). Генетика. 2015. Т. 51. № 10. C. 1199-1202. (IF 0.446). DOI: 10.7868/S0016675815100070.

Kaskinova M.D., Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Analysis of the Genetic Structure of Honeybee (Apis mellifera L.) Populations. Russian Journal of Genetics. 2015. V. 51. (10). P. 1199-1202. (IF 0.446). DOI: 10.7868/S0016675815100070.
  150. Ilyasov R. A., Kosarev M. N., Neal A. & Yumaguzhin F. G. Burzyan Wild-Hive Honeybee A.m.mellifera in South Ural. Bee World. 2015. V. 92 (1). P. 7-11. (IF 0.62). DOI: 10.1080/0005772X.2015.1047634.
A spontaneous hybridization among honeybees in most European countries has led to the loss in the gene pool of the dark European honeybee. We believe Russia still has a considerable array of purebred populations of European dark bees, A.m. mellifera. The most common bee, the Burzyan Honey Bee, lives under protection in the mountain forest zone of South Ural in the State Nature Biosphere Reserve “Shulgan-Tash”, the regional nature reserve “Altyn Solok”, and the National Park “Bashkortostan”. These wild tree hollow honeybees are of great interest among beekeepers and scientists around the world, as they could be used to help reconstruct the natural history of bees.
Ilyasov R. A., Kosarev M. N., Neal A. & Yumaguzhin F. G. Burzyan Wild-Hive Honeybee A.m.mellifera in South Ural. Bee World. 2015. V. 92 (1). P. 7-11. (IF 0.62). DOI: 10.1080/0005772X.2015.1047634.
  149. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Nucleotide polymorphism of the gene VG of honey bees. Biomics. 2015. V. 7 (1). P. 54-61.
Conservation of the gene pool of dark European bees A.m.mellifera is extremely important for the successful development of beekeeping in the Northern Eurasia. There  are many established methods for differentiating honey bee subspecies. This study  evaluated single nucleotide polymorphisms (SNP) as a marker for genotyping of honey  bees. The gene vitellogenin (Vg) is involved in the regulation of social organization of  honey bees. We sequenced Vg of dark European bees from Ural population and found 26  unique SNP for A.m.mellifera in its exons, which can be useful for genetic cataloging of  colonies.
Сохранение генофонда темной лесной пчелы A.m.mellifera чрезвычайно важно для успешного развития пчеловодства Северной Евразии. Существуют множество методов дифференциации подвидов медоносной пчелы. Наше исследование основано на оценке однонуклеотидного полиморфизма (SNP) и использования его в качестве маркера для генотипирования медоносных пчел. Ген вителлогенина (Vg) участвует в регуляции общественной организации в семье медоносной пчелы. Мы просеквенировали шесть экзонов гена Vg темных лесных пчел уральской популяции и нашли уникальные для A.m.mellifera 26 SNP, которые могут быть  полезны для генетической паспортизации семей.  
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Nucleotide polymorphism of the gene VG of honey bees. Biomics. 2015. V. 7 (1). P. 54-61.
  148. Ильясов Р.А., Косарев М.Н., Юмагужин Ф.Г. Бурзянская бортевая пчела и бортевое пчеловодство на Южном Урале. Пчеловодство. 2015. № 7. С. 12-15.

Бурзянская бортевая пчела и бортевое пчеловодство на Южном Урале (Burzyan wild-hive honeybee and wild-hive beekeeping in South Ural)
A spontaneous hybridization among honeybees in most European countries has led to the loss in the gene pool of the dark European honeybee. We believe Russia still has a considerable array of purebred populations of European dark bees A. m. mellifera. The commonest bee, the Burzyan Honey Bee, live under protection in the mountain forest zone of South Ural in the State Nature Biosphere Reserve «Shulgan-Tash», regional nature reserve «Altyn Solok» and National Park «Bashkortostan». These Wild Tree Hollow Honeybees are of great interest among beekeepers and scientists around the world, as they could be used to make a reconstruction of the natural history of bees.
На современном этапе развития пчеловодства в Евразии, на фоне массовой гибридизации подвидов пчел и потери генофонда темной лесной (среднеевропейской) пчелы в большинстве стран Европы, Россия располагает значительными массивами чистопородных популяций темной лесной пчелы A. m. mellifera. Наиболее известная популяция – бурзянская бортевая пчела – сохраняется в условиях бортевого пчеловодства, дикого обитания и пасек с рамочными ульями в горно-лесной зоне Южного Урала на территории государственного природного биосферного заповедника «Шульган-Таш», регионального природного заказника «Алтын Солок» и национального парка «Башкирия». Дикие и бортевые пчелы представляют большой интерес для пчеловодов и ученых всего мира, так как по ним можно сделать реконструкцию естественной истории пчел.
Ilyasov R.A., Kosarev M.N., Neal A., Yumaguzhin F.G. Burzyan wild-hive honeybee and wild-hive beekeeping in South Ural. Russian journal of beekeeping. 2015. V. 7. P. 12-15.
Ильясов Р.А., Косарев М.Н., Юмагужин Ф.Г. Бурзянская бортевая пчела и бортевое пчеловодство на Южном Урале. Пчеловодство. 2015. № 7. С. 12-15.
Publication Name: Ilyasov R.A., Kosarev M.N., Yumaguzhin F.G. Burzyan wild-hive honeybee and wild-hive beekeeping in South Ural. Russian journal of beekeeping. 2015. V. 7. P. 12-15.
  147. Ilyasov R.A., Poskryakov A.V., Petukhov A.V., Nikolenko A.G. Genetic Differentiation of Local Populations of the Dark European Bee Apis mellifera mellifera L. in the Urals. Russian journal of genetics. 2015. V. 51 (7). P. 677–682.  

Genetic Differentiation of Local Populations of the Dark European Bee Apis mellifera mellifera L. in the Urals
For the last two centuries, beekeepers in Russia and Europe have been introducing bees from the southern regions to the northern ones, subjecting the genetic pool of the dark European bee Apis mellifera mellifera L. subspecies to extensive hybridization. In order to reconfirm on the genetic level the previously published morphological data on the native bee population in the Urals, the Bashkortostan Republic, and the Perm Krai, we analyzed the polymorphism of the mitochondrial (mtDNA COI–COII intergenic locus) and nuclear (two microsatellite loci, ap243 and 4a110) DNA markers. Four local populations of the dark European bee A. m. mellifera surviving in the Urals have been identified, and their principal genetic characteristics have been determined. Data on the genetic structure and geographical localization of the areals of the dark European bee local populations in the Urals may be of use in restoring the damaged genetic pool of A. m. mellifera in Russia and other northern countries.
Publication Name: Ilyasov R.A., Poskryakov A.V., Petukhov A.V., Nikolenko A.G. Genetic Differentiation of Local Populations of the Dark European Bee Apis mellifera mellifera L. in the Urals. Russian journal of genetics. 2015. V. 51 (7). P. 677–682. DOI: 10.1134/S1022795415070042
  146. Шайнурова А.А., Ильясов Р.А., Поскряков А.В., Николенко А.Г. Сохранение генофонда популяции медоносной пчелы на территории Баймакского района Республики Башкортостан. Материалы II Международной научно-практической конференции «Биотехнологические аспекты развития современного пчеловодства». Киров. 3-4 мая 2015. С. 183-184.  

Медоносная пчела подвида Apis mellifera mellifera L. является аборигенной для республики Башкортостан. Для сохранения башкирской популяции этого подвида необходима разметка границ ее ареала (Николенко, Поскряков, 2002). Apis mellifera mellifera отличается зимостойкостью, устойчивостью к европейскому гнильцу, нозематозу и падевому токсикозу, а также высокой медопродуктивностью при коротком медосборе (например, с липы). У них сухая печатка мёда, что особенно ценно при зимовке в сложных условиях и при производстве высококачественного сотового меда. Именно эти уникальные признаки позволили разводить и содержать значительное количество пчелиных семей в суровом климате Южного Урала (Кожевников, 1929). Цель эксперимента заключалась в геногеографическом анализе популяции с целью определения сохранности генофонда башкирской пчелы в Баймакском районе.
Для исследования были отобраны пчелы с 13 пасек Баймакского района.
Мы исследовали на основе ПЦР-анализа полиморфизм межгенного локуса COI-COII митохондриальной ДНК. Аллель PQQ — маркер происхождения семьи башкирской породы A. m. mellifera по материнской линии. В дальнейшем нами были рассчитаны частоты встречаемости PQQ и Q.
Таким образом, нами было обнаружено восемь чистопородных пасек на территории Баймакского района. Остальные пять пасек оказались гибридными. Генофонд пчел баймакской популяции на большей части занимаемой территории характеризуется чистопородным происхождением аборигенной башкирской породы A. m. mellifera.
Honeybee subspecies Apis mellifera mellifera L. is a native of the Republic of Bashkortostan. To preserve the Bashkir population of this subspecies requires marking the boundaries of its range (Nikolenko, Poskryakov, 2002). Apis mellifera mellifera different hardiness, resistance to European foulbrood, nosema and honeydew toxicity, as well as high Medoproduktivnost short-honey collection (for example, linden). They dry signet honey, which is especially valuable for wintering in difficult conditions and the production of high-quality honeycomb. It is these unique features have allowed to breed and maintain a significant number of bee colonies in the harsh climate of the Southern Urals (Kozhevnikov, 1929). The purpose of the experiment was to analysis and gene geographic populations in order to determine the safety of the gene pool of the Bashkir bee in Baimak area.
For the study were selected from 13 apiaries bee Baimak area.
We investigated on the basis of PCR polymorphism intergenic locus COI-COII mitochondrial DNA. Allele PQQ - marker family of origin of the Bashkir breed A. m. mellifera through the maternal line. In the future, we calculated the incidence of PQQ and Q.
Thus, we found eight purebred Baimak apiaries in the territory of the district. The other five proved to be hybrid apiaries. The gene pool of bees Baimak population in most of the occupied territory is characterized purebred origin of the Bashkir breed indigenous A. m. mellifera.
  145. Ilyasov R.A., Kosarev M.N., Neal A., Yumaguzhin F.G. Burzyan wild-hive honeybee A. m. mellifera in South Ural. The Beekeepers Quarterly. 2015. V. 119. P. 25-33.  

Burzyan wild-hive honeybee A. m. mellifera in South Ural. A spontaneous hybridization among honeybees in most European countries has led to the loss in the gene pool of the dark European honeybee. We believe Russia still has a considerable array of pure bred populations of European dark bees A. m. mellifera. The commonest bee, the Burzyan Honeybee, lives under protection in the mountain forest zone of South Ural in the State Nature Biosphere Reserve 'Shulgan- Tash', regional nature reserve Altyn Solok' and National Park «Bashkortostan». These Wild Tree Hollow Honeybees are of great interest among beekeepers and scientists around the world, as they could be used to make a reconstruction of the natural history  of bees.
Publication Name: Ilyasov R.A., Kosarev M.N., Neal A., Yumaguzhin F.G. Burzyan wild-hive honeybee A. m. mellifera in South Ural. The Beekeepers Quarterly. 2015. V. 119. P. 25-33.
  144. Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Генетическая дифференциация локальных популяций темной лесной пчелы Apis mellifera mellifera L. на Урале. Генетика. 2015. Т. 51. № 7. С. 792–798.

Генетическая дифференциация локальных популяций темной лесной пчелы Apis mellifera mellifera L. на Урале (Genetic differenciation of local population of dark European bees Apis mellifera mellifera L. in Ural).
During the last two centuries, beekeepers in Russia and European countries imported bees from southern regions to the north, resulting in the gene pool of a dark forest bee subspecies Apis mellifera mellifera L. was subject to significant hybridization. To clarify the genetic level previously published in the literature on the morphological data native bee populations in the Urals, in the Republic of Bashkortostan and the Perm region we have analyzed markers of mitochondrial polymorphism (intergenic locus COI-COII mtDNA) and nuclear (two microsatellite loci, ap243 and 4a110) DNA . Select the four surviving local populations dark forest bees A. m. mellifera in the Urals and received their basic genetic characteristics. Data on the genetic structure and geographical location of areas of local populations dark forest bees in the Urals can be helpful in restoring the disturbed gene pool of A. m. mellifera in Russia and other northern countries.
В течение последних двух веков пчеловоды в России и европейских странах завозили пчел из южных регионов в северные, в результате чего генофонд темной лесной пчелы подвида Apis mellifera mellifera L. был подвержен значительной гибридизации. Для уточнения на генетическом уровне ранее опубликованных в литературе морфологических данных по аборигенной популяции пчел на Урале, в Республике Башкортостан и Пермском крае нами проведен анализ полиморфизма маркеров митохондриальной (межгенный локус COI-COII мтДНК) и ядерной (два микросателлитных локуса, ap243 и 4a110) ДНК. Выделены четыре сохранившиеся локальные популяции темной лесной пчелы A. m. mellifera на Урале и получены их основные генетические характеристики. Данные о генетической структуре и географической локализации ареалов локальных популяций темной лесной пчелы на Урале могут быть полезны при восстановлении нарушенного генофонда A. m. mellifera в России и других северных странах.
Publication Name: Ilyasov R.A., Poskryakov A.V., Petukhov A.V., Nikolenko A.G. Genetic differenciation of local population of dark European bees Apis mellifera mellifera L. in Ural. Russian journal of genetics, 2015. V. 51 (7). P. 792–798. DOI:10.7868/S0016675815070048
  143. Ilyasov R.A., Kosarev M.N., Neal A., Yumaguzhin F.G. Burzyan bees in South Ural. Bees for Development Journal. V. 114. 2015. P. 11-17.

Burzyan bees in South Ural
The hybridisation within honey bees in most European countries has led to loss of the European honey bee Apis mellifera mellifera gene pool. We believe that Russia still has pure populations of these European black bees. The most common honey bee, the Burzyan bee, is protected in the mountain forest zone of South Ural in the Shulgan-Tash State Nature Biosphere Reserve, the Altyn Solok Regional Nature Reserve and the Bashkortostan National Park. These bees nesting in hollow trees are of great interest for understanding the natural history of honey bees.
Ilyasov R.A., Kosarev M.N., Neal A., Yumaguzhin F.G. Burzyan bees in South Ural. Bees for Development Journal. V. 114. 2015. P. 11-17.
Publication Name: Ilyasov R.A., Kosarev M.N., Neal A., Yumaguzhin F.G. Burzyan bees in South Ural. Bees for Development Journal. V. 114. 2015. P. 11-17.
  142. Ilyasov R.A., Kosarev M.N., Neal A., Yumaguzhin F.G. Wild dark honey bees of the Urals. The Four Seasons. 2015. V. 55. P. 27-33.  

Wild dark honey bees of the Urals. A SPONTANEOUS hybridisation among honey bees in most European countries has led to the loss in the gene pool of the dark European honey bee (Apis mellifera mellifera). We believe Russia still has a considerable array of purebred populations of European dark bees. The most common bee, the Burzyan honey bee, lives under protection in the mountain forest zone of South Ural in the Shulgan-Tash State Nature Biosphere Reserve, the Altyn Solok Regional Nature Reserve and the Bashkortostan National Park. These wild tree-hollow honey bees are of great interest among beekeepers and scientists around the world, as they could be used to reconstruct the natural history of bees. The European dark bee is a unique subspecies of A. mellifera evolutionarily adapted to live in the continental climate of northern Eurasia, which has long cold winters. Today, this subspecies mostly survives only in a few isolated reservation areas. The biggest areas are in Russia, with about 300,000 colonies having avoided spontaneous hybridisation in the South Ural area of the Republic of Bashkirostan, about 200,000 colonies in the Middle Ural area and about 250,000 colonies in the Volga region of the Republic of Tatarstan. We also have information about large populations of European dark bee in the Altai region of the Republic of Udmurtia. About 99% of European dark bees in the South Ural are kept in framed hives in apiaries (Figure 1) and about 1% in both natural and specially made tree hollows. The evolution of the dark bee was synchronous with the evolution of the widely spreading linden tree Tilia cordata and therefore the main forage crop for these bees is when these trees blossom. Scientists at the Biochemical Insects Adaptation Laboratory in the Ufa Scienti c Centre of the Russian Academy of Science have been monitoring the gene pool of the Burzyan honeybees for the past 20 years using polymorphism of loci COI-COII of mtDNA and microsatellite loci ap243 and 4a110 of nuclear DNA. This extensive research con rmed the pureness of the gene pool and that this gene pool is of the A. m. mellifera subspecies. In 2011, upon request by the Institute of Beekeeping and the Shulgan-Tash State Reserve, bees from this population were classi ed as a separate breed type: the Burzyan wild-hive honey bee (Figure 2). This breed was registered patent No. 5956 from 14.06.2011 by the State Commission of the Russian Federation in the state register. According to artefacts found at a burial site of the Bahmutin culture near Birsk, beekeeping in the southern Ural started no later than 500-600BC among local Finno-Ugric tribes. Later beekeeping was adopted by ancestors of the Bashkir people, which assimilated and drove away the Bahmutin. Beekeeping did not require tools of iron, and the skills accumulated were passed on by many generations of tree-hollow beekeepers (Figure 3). Bashkir beekeeping  ourished in the 18th century. It took it longer to develop than in Germany, Poland, Lithuania, Belarus and central regions of Russia, but the Bashkir beekeepers had a more perfect, convenient and reliable set of tools and accessories. With special land tenure rights, the Bashkirs could avoid compliance with the requirements of the Forest Service in Russia, which in 1882 had banned beekeeping in state forests as a source of forest  res. In the 19th century due to deforestation and the destruction of their cultural traditions by the migrant population, Bashkir beekeepers developed ‘Koloda’ beekeeping, which involves the use of handmade hollows inside tree trunks (Figure 4) that could be  xed high on a tree. Trees with ‘Koloda’ were considered by Bashkirs as personal property and were marked with ‘Tamga’, distinctive signs of tribal a liation (Figures 5 and 6). Every beekeeper knew his mark and did not touch the property of others, and these trees with ‘Koloda’ and ‘Tamga’ were traditionally kept by a family for generations. In the second half of the 20th century, Bashkir beekeepers started using movable-frame hives, which gave rise to modern beekeeping. Despite the hard labour and low productivity, tree hollow apiculture in remote areas of the South Urals still continues. Inspections of hollow-tree hive bees require working at heights of up to 16 meters, and because they are located away from populated areas, the beekeeper has to travel on horseback a distance of 40-50km per day (Figures 7 and 8). Tools used by Bashkir beekeepers are mostly homemade but are similar to tools used in other countries. Tools unique to the Bashkir wild-hive beekeepers are the ‘Kiram’, a braided leather belt up to 5m in length for climbing a tree, and the ‘Lange’, a small portable platform or footrest (Figure 9), which is  xed on the trunk with a rope. In the last centuries, when there were enough natural tree hollows containing bees, Bashkirs, like beekeepers around the world, in the autumn took all the honey from the colony and the bees, left without reserves, died. In spring, beekeepers checked these tree hollows, cleaned them and made them ready for a new occupation by a swarm. This system of killing colonies to remove the honey was used until the 19th century and in some areas until the 1950s. The advantage of this system was that a new comb was created every year, tree hollows rot less and, as a result, bees were rarely sick, their body size did not decrease due to using old comb, and there was less chance of inbreeding and degeneration. However, when the number of natural tree hollows declined sharply, beekeepers were forced to carefully treat the wild-hive bees and leave the best of them with su cient honey for the winter. As a result, colonies were able to live a long time in the same place (up to 18-25 years!) and beekeepers had to learn how to replace a comb but the life of the hollows was reduced. Figure 10 shows an interior view of an arti cial hollowtree hive. Wild-hive bees in the Ural area also have many natural enemies that weaken the colony and cause their death. These are the brown bear (Ursus arctos), the pine marten (Martes martes), the forest mouse (Apodemus uralensis), the great spotted woodpecker (Dendrocopos major), the European beeeater (Merops apiaster), the large wax moth (Galleria mellonella), the European hornet (Vespa crabro), the red wood ant (Formica rufa), and the red wasp (Dolichovespula rufa). They also have not escaped modern honey bee diseases and parasites, such as the varroa mite, Nosema apis, chalkbrood disease, and American and European foulbrood. However, these diseases are more severe in modern, movable-frame hives than in treehollow hives. The population of tree-hollow bees has cyclical swings that depends on solar activity. Currently, dark European bees exist in the southern Urals in the Shulgan-Tash State Reserve, where they live in natural and handmade tree hollows. The reserve was established in 1958 and it covers an area of about 54,000 acres. The bees also live in the Altyn Solok regional nature reserve, established in 1997 with an area of 222,000 acres, and the Bashkiria national park, established in 1986 with an area of 203,000. At the end of 2014, these three national parks had about 1,200 trees with handmade tree hollow hives but only 300 of these had bees. About 4,000 colonies are kept in apiaries with modern movable-frame hives, and 200-400 colonies live in natural tree hollows. In 2012, these reserves were listed as specially protected areas, together with a number of others, and acquired the status of a ‘biosphere’ by UNESCO called the Bashkir Ural complex, with a total area of 855,000 acres. The Altyn Solok regional reserve is also protected by the Ministry of Environment of the Republic of Bashkortostan. Currently, in order to preserve the Burzyan honey bee, it is planned to expand the Shulgan-Tash reserve in a north-west direction through undeveloped territory between the rivers Nugush and Uruk. The sta  from Shulgan-Tash, Altyn Solok and Bashkiria, together with local beekeepers, are constantly taking measures to increase the bee population and carry on selection work to improve immunity, winter hardiness and productivity of the Burzyan bees. This policy of state protected reservations allows us to save a unique population of these A. m. mellifera bees in Eurasia in the face of new threats of spontaneous hybridization and habitat destruction.
Author a¬liations and Contacts RA Ilyasov1, Ufa Scienti c Centre of the Russian Academy of Science, Institute of Biochemistry and Genetics 450054, Russia, Ufa, prospect Oktyabrya, 71, Email: apismell@hotmail.com MN  osarev, Shulgan-Tash State Nature Reserve, Email: mnkos@mail.ru A Neal, UK beekeeper, Woking, Email: Alla. Neal@allaccounting.co.uk FG Yumaguzhin, Bashkir State Agrarian
  141. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Роль однонуклеотидных замен в гене вителлогенина при идентификации темной лесной пчелы. Пчеловодство. 2015. № 3. С. 22-24.  

Роль однонуклеотидных замен в гене вителлогенина при идентификации темной лесной пчелы (Role of single nucleotide polymorphism of the gene vitellogenin for dark forest bees identification)
Comparative analysis of nucleotide sequences of the gene Vg showed significant genetic variability in different subspecies of honey bees Apis mellifera. We found 24 single nucleotide polymorphism (SNP) wich can be used for genetic identification  of bees from M lineage (Apis mellifera mellifera) and С lineage (A. m. caucasica, A. m. carnica, A. m. carpatica, A. m. ligustica).
Сравнительный анализ нуклеотидной последовательности гена Vg показал значительную генетическую изменчивость у представителей разных подвидов медоносной пчелы Apis mellifera. Обнаруженные нами 24 однонуклеотидные замены (SNP) могут быть использованы в качестве ядерных SNP-маркеров для генетической дифференциации представителей пчел эволюционных ветвей М (Apis mellifera mellifera) и С (A. m. caucasica, A. m. carnica, A. m. carpatica, A. m. ligustica).
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Role of single nucleotide polymorphism of the gene vitellogenin for dark forest bees identification. Russian journal of beekeeping. 2015. V. 3. P. 22-24.
Publication Name: Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Role of single nucleotide polymorphism of the gene vitellogenin for dark forest bees identification. Russian journal of beekeeping. 2015. V. 3. P. 22-24.
  140. Брандорф А.З., Ильясов Р. А., Неал А. Пчеловодство Великобритании. Пчеловодство.2015. №1. С.64-66.  

Пчеловодство Великобритании (The Beekeeping of the Great Britain)
This paper says about the beekeeping international 50 year anniversary conference of BIBBA and SICAMM which was in Langollen (North Wales) at the september-october of 2014. We tell about most speakers and about features of British beekeeping. The conference was great experience for all participants. At this conference in first time was participated Russian scientists.
В статье кратко рассказано о пчеловодстве Великобритании. На основе материалов 13-й Конференции SICAMM показано значение темной пчелы (Apis mellifera mellifera) в равитии пчеловодства стран Европейского союза.
Brandorf A.Z., Ilyasov R.A., Neal A. The Beekeeping of the Great Britain. Russian journal of beekeeping. 2015. V.1. P. 64-66.
Publication Name: Brandorf A.Z., Ilyasov R.A., Neal A. The Beekeeping of the Great Britain. Russian journal of beekeeping. 2015. V.1. P. 64-66.
  139. Ильясов Р.А., Прощалыкин М.Ю., Поскряков А.В., Лелей А.С., Николенко А.Г. Популяция Apis cerana на Дальнем Востоке России. Биомика, 2014. Т. 3, № 2. С. 139-144.  

Популяция Apis cerana на Дальнем Востоке России (Apis cerana population in the Far East of Russia)
Китайская восковая пчела Apis cerana распространена преимущественно в Азии. В последнее время наблюдается резкое сокращение ареала и катастрофическое снижение численности дальневосточной популяции китайской восковой пчелы в уссурийской тайге в результате пожаров, вырубок широколиственных лесов и обработок леса от насекомых-вредителей. В Хасанском районе Приморского края в заказнике «Барсовый» и заповеднике «Кедровая падь» сохранилась небольшая популяция A.cerana. На основе секвенционного анализа локуса COI мтДНК мы обнаружили 4 генетические группы в дальневосточной популяции восковой пчелы A.cerana. Наибольшее генетическое сходство с другими азиатскими популяциями A.cerana наблюдалось у представителей пчел из Академгородка, заповедника Кедровая Падь, п. Ромашка. Наибольшее генетическое разнообразие наблюдалось в популяции пчел п. Ромашка. Для сохранения полноценной популяции восковой пчелы в России необходимо сохранить представителей всех четырех генетических групп для сохранения максимального уровня их генетического разнообразия.
Apis cerana distributed mainly in Asia. Recently there has been a sharp reduction in the range and the catastrophic decline of the population of the Far Eastern Apis cerana in the Ussuri taiga in fires, cuttings of deciduous forests and forest treatments from insect pests. In Khasan district of Primorye Territory in reserve "Barsovy" and reserve "Cedar Pad" remained a small population A.cerana. On the basis of analysis sekventsionnogo locus COI mtDNA, we found four genetic groups in the population of the Far Eastern bees wax A.cerana. The highest genetic similarity with other Asian populations A.cerana observed in bees representatives of Akademgorodok, Cedar Pad reserve, p. Chamomile. The greatest genetic diversity was observed in the population of bees p. Chamomile. To preserve the full population of bees wax in Russia is necessary to keep all four genetic groups to preserve their maximum level of genetic diversity.
Publication Name: Ilyasov R.A., Proshhalykin M.Yu., Poskryakov A.V., Leley A.S., Nikolenko A.G. Apis cerana population in the Far East of Russia. Biomics. 2014. V.3 (2). P. 139-144.
  138.Ильясов Р.А., Гайфуллина Л.Р., Салтыкова Е.С., Николенко А.Г. Биология, распространение и профилактика микроспоридий рода Nosema, паразитирующих на медоносной пчеле. Биомика, 2014. Т. 3, № 2. С. 145-154.  

Биология, распространение и профилактика микроспоридий рода Nosema, паразитирующих на медоносной пчеле (Biology, distribution, and prevention of microsporidia species of Nosema, parasited on honey bee)
В популяции пчел A. mellifera и A. cerana широко рапространены классический нозематоз типа А и азиатский нозематоз типа С - очень опасные микроспоридиозы, ведущие к потере продуктивности пчелиных семей и их гибели. Оба вида нозематоза имеют неравномерное распределение в ареале медоносной пчелы: разные регионы различаются как видовым составом, так и количественным содержанием микроспоридий. В распространении нозематоза большое значение имеет таксономическая принадлежность пчел - разные подвиды пчел имеют разную устойчивость к этому заболеванию: пчела подвида A.m.mellifera L., в отличие от пчел других подвидов наименее подвержена заражению нозематозом. В связи с тем, что вид N. ceranae, в сравнении с N.apis, характеризуется значительной устойчивостью к антибиотикам и фунгицидам, высокими уровнями вирулентности и темпа размножения, непредсказуемыми сроками манифестации нозематоза и широкой представленностью в тканях и органах организма медоносной пчелы, необходимо разрабатывать индивидуальные для каждого вида модифицированные методы профилактики и лечения.
In a population of bees A. mellifera and A. cerana widely raprostraneny nosema classic type A and type C nosema Asian - a very dangerous Microsporidiosis, leading to loss of productivity of bee colonies and their death. Both species have nosema uneven distribution in the area of ​​the honeybee: different regions differ both in species composition and quantitative content of microsporidia. In distributing nosema is very important taxonomic affiliation of bees - different subspecies of bees have different resistance to the disease: bee subspecies Ammellifera L., unlike bees other subspecies of the least likely to be infected nosema. Due to the fact that the form of N. ceranae, compared with N.apis, characterized by considerable resistance to antibiotics and fungicides, high levels of virulence and reproductive rate, unpredictable timing manifestation nosema and broad representation in the tissues and organs of the body of the honeybee, it is necessary to develop customized for each type of modified methods of prevention and treatment.
Publication Name: Ilyasov R.A., Gayfullina L.R., Saltykova E.S., Nikolenko A.G. Biology, distribution, and prevention of microsporidia species of Nosema, parasited on honey bee. Biomics V. 3 (2). 2014. 145-154.
  137.Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Генетические особенности островков популяции темной лесной пчелы на Урале. Пчеловодство. 2015. № 2. С. 20-22.  

Генетические особенности островков популяции темной лесной пчелы на Урале (Genetic features of island population of dark bees in Ural)
Современный ареал темной лесной пчелы Аpis mellifera mellifera L. значительно сократился в результате антропогенной деятельности и ухудшения экологических условий. Мы провели анализ полиморфизма маркеров митохондриальной (межгенный локус COI-COII мтДНК) и ядерной (два микросателлитных локуса ap243 и 4a110) ДНК с целью обнаружить сохранившиеся остатки генофонда темной лесной пчелы. В ходе проведенных исследований были обнаружены четыре островка сохранившейся популяции темной лесной пчелы A. m. mellifera на Урале и получены их основные генетические характеристики. Данные о генетической структуре и географической локализации островков сохранившейся популяции темной лесной пчелы на Урале могут быть использованы для восстановления в границах естественного ареала генофонда A. m. mellifera, нарушенного в результате гибридизации, в России и других странах Северной и Западной Европы.
The present area of the dark forest bee Apis mellifera mellifera L. significantly reduced as a result of human activities and environmental degradation. We have analyzed the polymorphism of mitochondrial markers (intergenic locus COI-COII mtDNA) and nuclear (two microsatellite loci ap243 and 4a110) DNA in order to detect the preserved remains of the gene pool of a dark forest bees. In the course of studies have found four remaining population of the island dark forest bees A. m. mellifera in the Urals and obtained their basic genetic characteristics. Data on the genetic structure and geographical location of islets surviving population of the dark forest bees in the Urals can be used to restore the natural habitat within the boundaries of the gene pool of A. m. mellifera, disturbed as a result of hybridization in Russia and other countries of Northern and Western Europe.
Publication Name: Ilyasov R.A., Poskryakov A.V., Petukhov A.V., Nikolenko A.G. Genetic features of island population of dark bees in Ural. Russian journal of beekeeping. 2015. V. 2. P. 20-22.
  136. Ильясов Р.А. Изоляты темной лесной пчелы Apis mellifera mellifera L. на Южном и Среднем Урале. Материалы Всероссийской научно-практической конференции с международным участием, посвященной 100-летию со дня рождения заслуженного деятеля науки РСФСР и Башкирской АССР, доктора биологических наук, профессора П.Т. Тихонова. 18 ноября 2014 г. Уфа: Башкирский ГАУ, 2014. С. 170-172.  

Темная европейская пчела A.m.mellifera является подвидом пчел, который экономически выгодно разводить на северных территориях Евразии. К сожалению, генофонд южных подвидов пчел в России постепенно вытесня- ет аборигенный генофонд темной лесной пчелы. На данный момент сохрани- лось очень мало резерватов темной лесной пчелы в Северной и Западной Евратемных европейских пчел (около 500 000 семей) преимущественно в двух регио- нах – Республике Башкортостан (около 300 000 семей) и Пермском крае (около 200 000 семей). Часть этих пчел обитает в бортях в лесу. На Урале были об- наружены около 10 популяций темной европейской пчелы географически изоли- рованных от других популяций горно-лесными массивами и расстояниями. Та- ким образом, популяции A.m.mellifera на Урале могут являться резервами для восстановления генофонда темно лесной пчелы на Северных территориях Евразии. Summary. Dark European honey bees A.m. mellifera is subspecies of bees which economically favourably for beekeepers to breeding in northern territories of Eurasia. Unfortunately native gene pool of a dark European honey bees gradually forced out by gene pool of southern subspecies of bees in Russia. At present remained very few reserves of dark European honey bees in Northern and Western Eurasia. In Russia in Urals is had huge pool of dark European honey bees (about 500 000 colonies) mainly in two regions – Bashkortostan republic (about 300 000 colonies) and Permskii Krai (about 200 000 colonies). The part of these bees is cave nesting in hollows of a trees. We found about 10 isolated populations of dark European honey bees in Urals. Thus Urals populations of dark European honey bees A.m.mellifera can be source for restoration of a gene pool of these bees in Northern territories of Eurasia. Ключевые слова: медоносная пчела, Apis mellifera mellifera, локус COI-COII, микросателлиты, популяционная генетика. Keywords: honey bee, Apis mellifera mellifera, locus COI-COII, microsatellites, population genetics. 
  135. Ilyasov R.A., Farkhutdinov R.G., Shareeva Z.V. Influence of acaricides amitraz and fluvalinate on average daily egg and total honey productivity of honey bee colonies. Biomics. 2014, V. 6 (2). P. 73-76.  

INFLUENCE OF ACARICIDES AMITRAZ AND FLUVALINATE ON AVERAGE DAILY EGG AND TOTAL HONEY PRODUCTIVITY OF HONEY BEE COLONIES
Varroa destructor Anderson & Trueman is widespread parasitic mite in honey bee population which causes varroosis. In Russia varroosis lead to mass losses of honey bee Apis mellifera L. colonies and their honey productivity. We have shown in our research negative impact of acaricides amitraz and fluvalinate on total honey and average daily egg productivity of honey bee colonies. We recommend in beekeeping no using against Varroa chemical acaricides and try treatment bees by alternative flours and extracts of medicinal plants in the season of honey collecting in summer. For most economically effectiveness of honey bee colonies treatment against Varroa by amitraz and fluvalinate can only in spring before honey collecting and in autumn after honey collecting seasons.
Publication Name: Ilyasov R.A., Farkhutdinov R.G., Shareeva Z.V. Influence of acaricides amitraz and fluvalinate on average daily egg and total honey productivity of honey bee colonies. Biomics. 2014, V. 6 (2). P. 73-76.
  134. Фархутдинов Р.Г., Ильясов Р.А., Юмагужин Ф.Г., Туктарова Ю.В., Шафикова В.М., Абдуллин М.Ф. Биологический стимулятор продуктивности пчелиной семьи с фунгицидной активностью. Биомика, 2014. Т. 6, № 2. С. 68-72.  

БИОЛОГИЧЕСКИЙ СТИМУЛЯТОР ПРОДУКТИВНОСТИ ПЧЕЛИНОЙ СЕМЬИ С ФУНГИЦИДНОЙ АКТИВНОСТЬЮ (Biological stimulator for honey bee colony productivity with fungicidal activity)
Аскосфероз – инфекционная болезнь пчелиной семьи, вызываемая паразитическим грибком Ascosphaera apis. Аскосфероз подавляет развитие пчелиной семьи и может привести к гибели при отсутствии лечения и стимуляции иммунитета. Химические препараты с фунгицидным действием очень эффективны в борьбе с аскосферозом, но обладают побочными действиями. В данной статье мы описали препарат, представляющий собой спиртовый экстракт растительного сбора, обладающий одновременно фунгицидным и стимулирующим эффектом для пчелиной семьи. Применение этого препарата может повысить продуктивность пчелиной семьи и снизить затраты на ее содержание.
Askosphaerosis - infectious disease of bees caused by a parasitic fungus Ascosphaera apis. Askosphaerosis suppresses the development of bee colonies and can lead to death if untreated and stimulation of immunity. Chemicals with fungicidal action are very effective in combating askosferozom, but they have side effects. In this article we describe the drug, which is a collection of alcoholic extract of plant that has both fungicidal and stimulating effect for the bee colony. Its use can increase the productivity of the bee families and reduce the cost of its maintenance.
Publication Name: Farkhutdinov R.G., Ilyasov R.A., Yumaguzhin F.G., Tuktarova Y.V., Shafikova V.M., Abdullin M.F. Biological stimulator for honey bee colony productivity with fungicidal activity. Biomics, 2014. V. 6 (2). P. 68-72.
  133. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. New SNP Markers of the Honeybee Vitellogenin Gene (Vg) Used for Diagnostics of Subspecies Apis mellifera mellifera L. in Russia. Russian Journal of Genetics, 2015. V. 51 (2), P. 163–168.  

New SNP Markers of the Honeybee Vitellogenin Gene (Vg) Used for Diagnostics of Subspecies Apis mellifera mellifera L. in Russia
Preservation of the gene pool of honeybee subspccies Apis mellifera mellifera is of vital importance for successful beekeeping development in the northern regions of Eurasia. An effective method of genotyping honeybee colonies used in modern science is the mapping of sites of single nucleotide polymorphism (SN P). The honeybee vitellogenin gene (Vg) encodes a protein that affects reproductive function, behavior, immunity, longevity, and social organization in the honeybee Apis mellifera and is therefore a topical research subject. The results of comparative analysis of honeybee Vg sequences show that there are 26 SNP sites that differentiate M and С evolutionary branches and can be used as markers in selective breeding, DNA-barcoding, and the creation of genetic passports for A.m. mellifera colonies.
Publication Name: Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. New SNP Markers of the Honeybee Vitellogenin Gene (Vg) Used for Diagnostics of Subspecies Apis mellifera mellifera L. in Russia. Russian Journal of Genetics, 2015. V. 51 (2), P. 163–168.
  132. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Fragment of tRNALeu-COII sequences from mtDNA of bees from Bashkortostan republic of Russia. GenBank. 2014. accession numbers KM242632-KM242643 (http://www.ncbi.nlm.nih.gov).  

LOCUS KM242632 761 bp DNA linear INV 21-OCT-2014
DEFINITION Apis mellifera mellifera isolate 4369 COI-COII intergenic spacer,
partial sequence; and cytochrome c oxidase subunit II (COII) gene,
partial cds; mitochondrial.
ACCESSION KM242632
VERSION KM242632
KEYWORDS .
SOURCE mitochondrion Apis mellifera mellifera (German honeybee)
ORGANISM Apis mellifera mellifera
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
Aculeata; Apoidea; Apidae; Apis.
REFERENCE 1 (bases 1 to 761)
AUTHORS Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
TITLE Fragment of tRNALeu-COII sequences from mtDNA of bees from
Bashkortostan republic of Russia
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 761)
AUTHORS Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
TITLE Direct Submission
JOURNAL Submitted (29-JUL-2014) Ufa Scientific Center of Russian Academy of
Sciences, Institute of Biochemistry and Genetics, Prospekt
Oktyabrya, 71, Ufa, Bashkortostan 450054, Russia
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..761
/organism="Apis mellifera mellifera"
/organelle="mitochondrion"
/mol_type="genomic DNA"
/isolate="4369"
/sub_species="mellifera"
/db_xref="taxon:44477"
/country="Russia: Bashkortostan Republic, Beloreckii
region, Kagarmanovo"
/collection_date="10-Jul-2013"
/collected_by="Ilyasov R.A."
misc_feature <1..467
/note="COI-COII intergenic spacer"
gene 468..>761
/gene="COII"
CDS 468..>761
/gene="COII"
/codon_start=1
/transl_table=5
/product="cytochrome c oxidase subunit II"
/protein_id="AIT97095"
/translation="MSTWFMFMFQESNSYYADNLISFHNMVMMIIIMISALTVYIILD
LFMNKFSNLFLLKNHNIEVIWTIIPIIILLIICFPSLKILYLIDEIVNPFFSIK"
ORIGIN
1 ttttttaact tttattaaaa ttaataaatt aatataaaat atgaattata tttattaaaa
61 tttaatttat taaaattttc cacttaattc attttaattt aaaaatataa ttaaataaca
121 atttttaata aaataaataa ttaattttat ttttatattg aattttaaat tcaatcttaa
181 agatttaatc tttttattaa aattaataaa ttaatataaa aaataaaaca aaatataaca
241 aaatatattt attaaaattt aatttattaa aatttcccac ttaattcatt ttaatttaaa
301 aataaattaa ataacaattt ttaataaaat aaataattaa ttttattttt atattgaatt
361 ttaaattcaa tcttaaagat ttaatctttt tattaaaatt aataaattaa tataaaaaat
421 aaaacaaaat ataacaaaat atatttatta aaatttaatt tattaaaatt tccacatgat
481 tcatatttat atttcaagaa tcaaattcat attatgctga taatttaatt tcatttcata
541 atatagttat aataatcatt attataattt cagcattaac tgtatatatt attttagatt
601 tatttataaa caaattttca aatttatttt tattaaaaaa tcataatatt gaagttattt
661 gaacaattat tccaattatt attctattaa ttatttgttt tccatcatta aaaattttat
721 atttaattga tgaaattgta aatccttttt tttcaattaa a
//
  131. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Molecular phylogenetics of honey bee subspecies Apis mellifera L. by polymorphism gene ND2. GenBank. 2014. accession numbers KM242606-KM242631 (http://www.ncbi.nlm.nih.gov).  

LOCUS KM242606 552 bp DNA linear INV 21-OCT-2014
DEFINITION Apis mellifera mellifera isolate 4401 NADH dehydrogenase subunit 2
(ND2) gene, partial cds; mitochondrial.
ACCESSION KM242606
VERSION KM242606
KEYWORDS .
SOURCE mitochondrion Apis mellifera mellifera (German honeybee)
ORGANISM Apis mellifera mellifera
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
Aculeata; Apoidea; Apidae; Apis.
REFERENCE 1 (bases 1 to 552)
AUTHORS Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
TITLE Molecular phylogenetics of honey bee subspecies Apis mellifera L.
by polymorphism gene ND2
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 552)
AUTHORS Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
TITLE Direct Submission
JOURNAL Submitted (25-JUL-2014) Ufa Scientific Center of Russian Academy of
Sciences, Institute of Biochemistry and Genetics, Prospekt
Oktyabrya, 71, Ufa, Bashkortostan 450054, Russia
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..552
/organism="Apis mellifera mellifera"
/organelle="mitochondrion"
/mol_type="genomic DNA"
/isolate="4401"
/sub_species="mellifera"
/db_xref="taxon:44477"
/country="Russia: Bashkortostan Republic, Abzelilovskii
region, Kirdas"
/collection_date="01-Jun-2013"
/collected_by="Ilyasov R.A."
gene <1..>552
/gene="ND2"
CDS <1..>552
/gene="ND2"
/codon_start=2
/transl_table=5
/product="NADH dehydrogenase subunit 2"
/protein_id="AIT97069"
/translation="FFMNFKYHWFIYLLITIFVLMMNSNNIFIQWMLMEFGTIISISL
INIKSTNKTPSLIYYSVSVISSIFLFFMIIVYLSSISFTKTDTFNFMVQMMFFLKIGT
FPFHFWMIYSYEMMNWKQIFLMSTLIKFIPIYMMVSMTKINSWTLYFLITNSLYISFY
ANKFYTLKKLLACSTIFNSFYFI"
ORIGIN
1 tttcttcata aattttaaat accactgatt tatttatctt ttaattacta tttttgtatt
61 aataataaat tccaataata tttttattca atgaatatta atagaatttg gtacaatcat
121 tagaattaga ttaattaata ttaaatccac aaataaaacc ccaagattaa tttattattc
181 agtatcagta atttcaagaa tttttttatt ctttataatt attgtatact tatcatccat
241 tagatttact aaaacagata cttttaattt tatagttcaa ataatatttt ttttaaaaat
301 tggaactttc ccttttcatt tttgaataat ttattcttat gaaataataa attgaaagca
361 aattttttta atatcaacat taattaaatt tattccaatt tatataatag tttcaataac
421 taaaattaat tcatgaacat tatatttttt aattacaaat agattatata tttcatttta
481 tgcaaataaa ttttatactc taaaaaaatt attagcatgc tcaacaattt ttaattcatt
541 ctatttcatt tt
//
  130. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Polymorphism of 1 intron of elongation factor 1 alpha (EF1-alpha) of Apis mellifera mellifera from Bashkortostan republic in Russia. GenBank. 2014. accession numbers KM242603-KM242605 (http://www.ncbi.nlm.nih.gov).

 LOCUS KM242606 552 bp DNA linear INV 21-OCT-2014
DEFINITION Apis mellifera mellifera isolate 4401 NADH dehydrogenase subunit 2
(ND2) gene, partial cds; mitochondrial.
ACCESSION KM242606
VERSION KM242606
KEYWORDS .
SOURCE mitochondrion Apis mellifera mellifera (German honeybee)
ORGANISM Apis mellifera mellifera
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
Aculeata; Apoidea; Apidae; Apis.
REFERENCE 1 (bases 1 to 552)
AUTHORS Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
TITLE Molecular phylogenetics of honey bee subspecies Apis mellifera L.
by polymorphism gene ND2
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 552)
AUTHORS Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
TITLE Direct Submission
JOURNAL Submitted (25-JUL-2014) Ufa Scientific Center of Russian Academy of
Sciences, Institute of Biochemistry and Genetics, Prospekt
Oktyabrya, 71, Ufa, Bashkortostan 450054, Russia
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..552
/organism="Apis mellifera mellifera"
/organelle="mitochondrion"
/mol_type="genomic DNA"
/isolate="4401"
/sub_species="mellifera"
/db_xref="taxon:44477"
/country="Russia: Bashkortostan Republic, Abzelilovskii
region, Kirdas"
/collection_date="01-Jun-2013"
/collected_by="Ilyasov R.A."
gene <1..>552
/gene="ND2"
CDS <1..>552
/gene="ND2"
/codon_start=2
/transl_table=5
/product="NADH dehydrogenase subunit 2"
/protein_id="AIT97069"
/translation="FFMNFKYHWFIYLLITIFVLMMNSNNIFIQWMLMEFGTIISISL
INIKSTNKTPSLIYYSVSVISSIFLFFMIIVYLSSISFTKTDTFNFMVQMMFFLKIGT
FPFHFWMIYSYEMMNWKQIFLMSTLIKFIPIYMMVSMTKINSWTLYFLITNSLYISFY
ANKFYTLKKLLACSTIFNSFYFI"
ORIGIN
1 tttcttcata aattttaaat accactgatt tatttatctt ttaattacta tttttgtatt
61 aataataaat tccaataata tttttattca atgaatatta atagaatttg gtacaatcat
121 tagaattaga ttaattaata ttaaatccac aaataaaacc ccaagattaa tttattattc
181 agtatcagta atttcaagaa tttttttatt ctttataatt attgtatact tatcatccat
241 tagatttact aaaacagata cttttaattt tatagttcaa ataatatttt ttttaaaaat
301 tggaactttc ccttttcatt tttgaataat ttattcttat gaaataataa attgaaagca
361 aattttttta atatcaacat taattaaatt tattccaatt tatataatag tttcaataac
421 taaaattaat tcatgaacat tatatttttt aattacaaat agattatata tttcatttta
481 tgcaaataaa ttttatactc taaaaaaatt attagcatgc tcaacaattt ttaattcatt
541 ctatttcatt tt
//
  129. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Polymorphism of gene COI of Apis cerana from Far East population in Russia. GenBank. 2014. accession numbers KM242593-KM242602 (http://www.ncbi.nlm.nih.gov).

LOCUS KM242593 668 bp DNA linear INV 21-OCT-2014
DEFINITION Apis cerana cerana isolate 3929 cytochrome c oxidase subunit I
(COI) gene, partial cds; mitochondrial.
ACCESSION KM242593
VERSION KM242593
KEYWORDS .
SOURCE mitochondrion Apis cerana cerana
ORGANISM Apis cerana cerana
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
Aculeata; Apoidea; Apidae; Apis.
REFERENCE 1 (bases 1 to 668)
AUTHORS Ilyasov,R.A., Poskryakov,A.V., Proshalykin,M.Y. and Nikolenko,A.G.
TITLE Polymorphism of gene COI of Apis cerana from Far East population in
Russia
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 668)
AUTHORS Ilyasov,R.A., Poskryakov,A.V., Proshalykin,M.Y. and Nikolenko,A.G.
TITLE Direct Submission
JOURNAL Submitted (25-JUL-2014) Ufa Scientific Center of Russian Academy of
Sciences, Institute of Biochemistry and Genetics, Prospekt
Oktyabrya, 71, Ufa, Bashkortostan 450054, Russia
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..668
/organism="Apis cerana cerana"
/organelle="mitochondrion"
/mol_type="genomic DNA"
/isolate="3929"
/sub_species="cerana"
/db_xref="taxon:94128"
/country="Russia: Primorskii Krai, Vladivostok,
Akademgorodok"
/collection_date="15-May-2010"
/collected_by="Ilyasov R.A., Proshalykin M.Y."
gene <1..>668
/gene="COI"
CDS <1..>668
/gene="COI"
/codon_start=1
/transl_table=5
/product="cytochrome c oxidase subunit I"
/protein_id="AIT97059"
/translation="LALWSGMLGSSMSLIVRMELSSPGSWINNDQIYNTVVTSHAFLM
IFFMVMPFLIGGFGNWLIPLMLGSPDMAFPRMNNISFWLLPPSLFMLLLSNLFYPSPG
TGWTVYPPLSAYLYHSSPSVDFAIFSLHMSGISSIMGSLNLMVTIMMMKNFSLNYDQI
SLFPWSVFITAILLIMSLPVLAGAITMLLFDRNFNTSFFDPMGGGDPILYQHLFWFFG
HPEV"
ORIGIN
1 ttagccttat gatcaggaat attaggctca tcaataaggt tgattgttcg catagaatta
61 agatcccccg gttcatgaat taataatgat caaatttata atacagttgt aacaagacat
121 gcattcctaa taattttttt tatagttata ccattcctaa ttggaggttt tggaaattga
181 ttaattcctt taatattagg atctccagat atagcatttc ctcgaataaa taatattaga
241 ttctgattgc ttcctccttc attatttata ttattattaa gaaatttatt ttatccaaga
301 ccaggaacag gatgaacagt ttatcctcca ttatctgcat atttatatca ttcatccccc
361 tcagttgatt ttgcaatttt ttccttacat atatctggaa tctcatcaat tataggatca
421 ttaaatttaa tagttacaat tataataata aaaaattttt cattaaatta tgatcaaatt
481 tctttatttc catgatcagt atttattaca gcaattttat taattatatc tcttccagtt
541 ctagctggag caattacaat attattattt gatcgaaatt ttaatacttc attttttgat
601 ccaataggag gtggagatcc aattttatat caacatttat tttgattttt tggtcaccca
661 gaagttta
//
  128. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Polymorphism of Ascosphaera apis 5.8SrRNA in Bashkortostan republic. GenBank. 2014. accession numbers KM242589-KM242592 (http://www.ncbi.nlm.nih.gov).

LOCUS KM242589 533 bp DNA linear PLN 26-OCT-2014
DEFINITION Ascosphaera apis isolate 4078 internal transcribed spacer 1,
partial sequence; 5.8S ribosomal RNA gene and internal transcribed
spacer 2, complete sequence; and 28S ribosomal RNA gene, partial
sequence.
ACCESSION KM242589
VERSION KM242589.1 GI:698364706
KEYWORDS .
SOURCE Ascosphaera apis
ORGANISM Ascosphaera apis
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
Eurotiomycetes; Eurotiomycetidae; Onygenales; Ascosphaeraceae;
Ascosphaera.
REFERENCE 1 (bases 1 to 533)
AUTHORS Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
TITLE Polymorphism of Ascosphaera apis 5.8SrRNA in Bashkortostan republic
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 533)
AUTHORS Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
TITLE Direct Submission
JOURNAL Submitted (24-JUL-2014) Ufa Scientific Center of Russian Academy of
Sciences, Institute of Biochemistry and Genetics, Prospekt
Oktyabrya, 71, Ufa, Bashkortostan 450054, Russia
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..533
/organism="Ascosphaera apis"
/mol_type="genomic DNA"
/isolate="4078"
/host="Apis mellifera mellifera"
/db_xref="taxon:5105"
/country="Russia: Bashkortostan Republic, Davlekanovskii
region, Mesyagutovo"
/collection_date="01-Jul-2013"
/collected_by="Ilyasov R.A."
misc_RNA <1..186
/product="internal transcribed spacer 1"
rRNA 187..344
/product="5.8S ribosomal RNA"
misc_RNA 345..511
/product="internal transcribed spacer 2"
rRNA 512..>533
/product="28S ribosomal RNA"
ORIGIN
1 ggtgccccta aacaaggccc tgccgcgcac tcccaccctt gtctacctta cctgttgctt
61 cggcgggcct gcgggttctc gcgagcctgc tgccggaggg gttagttccc ccctggctag
121 cgtccgccga agataaacga actccagtcg aagattgaag tctgaagaaa attgataaat
181 aaatcaaaac tttcaacaac ggatctcttg gttccgacat cgatgaagaa cgcagcgaaa
241 tgcgataagt aatgtgaatt gcagaattcc gtgaatcatc gaatctttga acgcacattg
301 cgccctctgg tattccgggg ggcatgcctg tccgagcgtc attgcaaccc tcaagcacgg
361 cttgtgtgtt gggcgatcgt cccgtcttag gagggacgcg cccgaaaggc agtgacggcg
421 tcgtgttccg gtgcccgagc gtatggggct ttgtctttcg ctctagtggc ctggccgact
481 gtccggtcta accatcattt acttctagtg gttgacctcg gatcaggtag ggt
//
  127. Ilyasov R.A., Poskryakov A.V., Nikolenko A. G. Polymorphism of Nosema apis SSUrRNA in Bashkortostan Republic. GenBank. 2014. accession numbers KM242585-KM242588 (http://www.ncbi.nlm.nih.gov).  

LOCUS KM242585 437 bp DNA linear PLN 26-OCT-2014
DEFINITION Nosema apis isolate 4079-1 small subunit ribosomal RNA gene,
partial sequence.
ACCESSION KM242585
VERSION KM242585.1 GI:698364701
KEYWORDS .
SOURCE Nosema apis
ORGANISM Nosema apis
Eukaryota; Fungi; Microsporidia; Nosematidae; Nosema.
REFERENCE 1 (bases 1 to 437)
AUTHORS Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
TITLE Polymorphism of Nosema apis SSUrRNA in Bashkortostan Republic
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 437)
AUTHORS Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
TITLE Direct Submission
JOURNAL Submitted (24-JUL-2014) Ufa Scientific Center of Russian Academy of
Sciences, Institute of Biochemistry and Genetics, Prospekt
Oktyabrya, 71, Ufa, Bashkortostan 450054, Russia
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..437
/organism="Nosema apis"
/mol_type="genomic DNA"
/isolate="4079-1"
/host="Apis mellifera mellifera"
/db_xref="taxon:35231"
/country="Russia: Bashkortostan Republic, Davlekanovskii
region, Mesyagutovo"
/collection_date="01-Jul-2013"
/collected_by="Ilyasov R.A."
rRNA <1..>437
/product="small subunit ribosomal RNA"
ORIGIN
1 atgcatgtct ttgacgtact atgtactgaa agatggactg ctcagtaata ctcactttat
61 ttgatgtacc ttatacataa ctacgttaaa gtgtagctaa catatgtaca gtaagagtga
121 gacctatcag ctagttgtta aggtaatggc ttaacaaggc aataacgggt aacggtatta
181 ctttgtaata ttccggagaa ggagcctgag agacggctac taagtctaag gattgcagca
241 ggggcgaaac ttgacctatg gatattatct gaggcagtta tgggaagtaa catagttgtt
301 tcacatttta aacgtatgtg agcagattaa ttggagggca aatcgagtgc cagcagccgc
361 ggtaatactt gttccaagag tgtgtatgat gattgatgca gttaaaaagt ccgtagttta
421 ttgttaagaa gcaatat
//
  126. Ильясов Р.А., Шареева З.В. Влияние акарицидов на медоносную пчелу при лечении варроатоза. Аграрная Россия. № 10. 2014. С. 21-22.  

Влияние акарицидов на медоносную пчелу при лечении варроатоза (Effect of acaricides on honey bees under the treatment against varroatosis)
Показано, что некоторые акарнцнды (амитраз и флувалинат) оказывают негативное влияние на пчелиные семьи. Для лечения варроатоза оптимально использовать только терапевтические дозы акарицидов. Превышение дозы акарицидов в 1,5 раза может снизить все характеристики пчелиной семьи в 1,3 раза. Во всех четырех экспериментальных группах, обработанных флувалинатом и амитразом, снизились экономически полезные показатели пчелиных семей. Муравьиная кислота оказывает минимальное негативное влияние на состояние пчелиной семьи.
It has been shown that some akarntsndy (amitraz and fluvalinate) have a negative impact on bees. For the treatment of varroatosis optimal use only therapeutic doses acaricides. Doses in excess of 1.5 times acaricides may reduce all the features of the bee colony is 1.3 times. In all four experimental groups treated fluvalinate and amitraz, declined economically useful indicators of bee colonies. Formic acid has minimal negative impact on the bee colony.
Publication Name: Ilyasov R.A., Shareeva Z.V. Effect of acaricides on honey bees under the treatment against varroatosis. Agrarian Russia. V. 10. 2014. P. 21-22.
  125. Nikolenko A.G., Ilyasov R.A., Poskryakov A.V., Saltykova E.S. The gene geographic analysis of Burzyan population of Apis mellifera mellifera L. Materials of international Sixth European Conference of Apidology "EURBEE 6". Murcia. Spain. 9 -11 September 2014. P. 52-53.  

High honeybee colony losses in North America and Europe again recalled the importance of preservation of one’s gene pool (Johnson, 2010). The 43 Apimondia Congress (2013) have noted the research of local aborigine populations as a key direction of modern conservation beekeeping. Aborigine honeybee populations are being restored in Sicily (Costa, 2013), Greece, Cyprus (Bouga, Hatjina, 2013) and other parts of Europe. Since 2008 the gene geographic analysis of Burzyan population of A.m. mellifera in the South Urals was performed by mitochondrial (tRNA-Leu - COII) and 9 microsatellite (Ap243, 4A110, A24, A8, A43, Al 13, A88, Ap049 и A28) markers. The population area, genetic structure and molecular diversity have been analyzed in this study. In total samples from 1102 colonies, 206 apiaries and 10 districts in a mountain-wood zone were analyzed. The sequence of the locus COl-COII mtDNA helped identify new M line mitotypes, which can be used as genetic markers for Ural honeybee. The population border was mapped, one is occupying an area two times greater than previously thought. The total number of genetically pure colonies reaches nearly 10 thousand. The genetic differentiation of Burzyan population from other A.m. mellifera in the Urals was shown with the optimal conservation strategy for the honeybee in Russian conditions being proposed.
  124. Ilyasov R.A. Isolates of Dark European honey bees Apis mellifera. Materials of international SICAMM 13th biennial and BIBBA 50th anniversary conference. Llangollen, North Wales. 26- 30 september 2014. P. 15.

Lecturer: A. Rustem Ilyasov. Russia
Institute of Biochemistry and Genetics of Ufa Science Centre RAS.
I am a population geneticist and molecular biologist specialising in honey bees Apis mellifera. I have worked in the laboratory of biochemistry of insect adaptability since 2002 and I am studying the honey bee subspecies A.m.mellifera in Russia. In 2006 I was awarded a PhD degree.
We analyze polymorphisms of 9 chromosomal microsatellite loci ap243, 4al I 0, a24, a8, a43, al I 3, ap049, a88, a28, and also a sequencing of loci COI-COII, COI, ND2 mtDNA and loci EFl -a, Vg of nuclear DNA in the laboratory. We also identify diseases of honey bees by RT-PCR: American and European foulbrood, Ascospherosis, Nose- matosis and Virus infections.
We also carry out biochemical research on the immunity of honey bees, and molecular biological research into the expression of genes of Vitellogenin, Defensin, Hy- menoptaecin, Abaecin, Cytochrome C Oxidase subunit I and II, Cytoplasmatic Cu-Zn superoxide dismutase I, Mitochondrial Mn Superoxide dismutase 2, Catalase, Thiore- doxin reductase, Mitochondrial thioredoxin peroxidase 3,and Glutathione peroxidase I.
Lecture: Isolates of Dark European honey bees Apis mellifera
mellifera L. in the Ural Mountains (Russia)
The Russian Urals contain a huge pool of dark European honey bees (about 500,000 colonies) mainly in two regions - the Bashkortostan republic (about 300,000 colonies) and Permskii Krai (about 200,000 colonies). Some of these bees “cave nest” in hollow tree trunks.
We have demonstrated their taxonomic identity with Apis mellifera mellifera by DNA analysis: by sequencing of loci at COI-COII and ND2 in the mtDNA and from polymorphism analysis of 9 chromosomal microsatellite loci (ap243, 4al I 0, a24, a8, a43, al I 3, ap049, a88, a28). We have located about five isolated populations of dark European honey bees in the Urals: in the national park Shulgan-Tash (South Urals), the wildlife area Altyn-Solok (South Urals), national park Bashkiriya (South Urals) in the Bashkortostan republic and the wildlife area Malinovyi Hutor (Middle Urals) and the national park Visherskii (North Urals) in Permaskii Krai. This Ural population of dark European honey bees could be a source for restoration of a gene pool of these bees in North and West Eurasia. 
  123. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Новые SNP маркеры в гене вителлогенина Vg медоносной пчелы для идентификации Аpis mellifera mellifera L. Генетика, 2015, том 51, № 2, с. 196–199.

Новые SNP маркеры в гене вителлогенина Vg медоносной пчелы для идентификации Аpis mellifera mellifera L. (New SNP markers in the gene vitellogenin Vg of honeybees for diagnosis Аpis mellifera mellifera L. in Russia)
Сохранение генофонда медоносной пчелы подвида А т. mellifera чрезвычайно важно для успешного развития пчеловодства в северных регионах Евразии. Генотипирование пчелиных семей на современном этапе развития науки очень эффективно проводить на основе сайтов однонуклеотидных замен (SNP). Ген вителлогенина (Vg) медоносной пчелы, кодирующий белок, участвующий в регуляции размножения, поведения, иммунитета, продолжительности жизни и социальной организации особей медоносной пчелы Apis mellifera, представляет большой интерес для изучения. В результате сравнительного анализа нуклеотидной последовательности гена Vg медоносной пчелы мы обнаружили 26 SNP, дифференцирующих пчел эволюционных ветвей М и С, которые могут быть использованы в качестве генетических маркеров в селекции подвида А. т. mellifera, в проведении генетического штрихкодирования и создании генетического паспорта пчелиных семей.
Preservation of the gene pool of the honeybee subspecies A m. Mellifera is extremely important for the successful development of beekeeping in the northern regions of Eurasia. Genotyping of bee colonies at the present stage of development of science is very effective to conduct site-based single-nucleotide substitutions (SNP). Gene vitellogenin (Vg) of the honeybee, encoding a protein involved in the regulation of reproduction, behavior, immunity, longevity and social organization of individuals of the honeybee Apis mellifera, is of great interest for the study. A comparative analysis of the nucleotide sequence of Vg gene honeybee we found 26 SNP, differentiating bees evolutionary branches of M and C, which can be used as genetic markers in breeding subspecies A. m. Mellifera, in conducting genetic barcoding and the creation of a genetic passport bee colonies .
Publication Name: Ilyasov R.A., Poskryakov A.V. Nikolenko A.G. New SNP markers in the gene vitellogenin Vg of honeybees for diagnosis Аpis mellifera mellifera L. in Russia. Russian journal of genetics, 2015. V. 51 (2), P. 194–199.
  122. Фархутдинов Р.Г., Ильясов Р.А., Юмагужин Ф.Г., Туктарова Ю.В., Шафикова В.М., Абдуллин М.Ф. Фунгицид и стимулятор пчелиной семьи растительного происхождения. Пчеловодство. 2014. № 9. С. 33-35.  

Фунгицид и стимулятор пчелиной семьи растительного происхождения (Plant origin fungicide and stimulator of bee colonies)
Аскосфероз подавляет развитие семьи и может привести к ее гибели мри отсутствии лечения и стимуляции иммунитета. Химические препараты с фунгицидным действием очень эффективны в борьбе с аскосферозом, но обладают побочными действиями. Применение спиртового экстракта растительного сбора, обладающего одновременно фунгицидным и стимулирующим эффектом, поможет также повысить продуктивность пчелиной семьи и снизить затраты на ее содержание.
Askosphaerosis suppresses the development of the family and may lead to its demise MRI untreated and stimulation of immunity. Chemicals with fungicidal action are very effective in combating askosferozom, but they have side effects. The use of alcoholic extract of plant collection, has both fungicidal and stimulating effect, will also help to improve the productivity of bees and reduce the cost of its maintenance.
Publication Name: Farkhutdinov R.G., Ilyasov R.A., Yumaguzhin F.G., Tuktarova Y.V., Shafikova V.M., Abdullin M.F. Plant origin fungicide and stimulator of bee colonies. Russian journal of beekeeping. 2014. V. 9. 33-35.
  121. Ilyasov R.A., Poskryakov A.V. Phylogenetics of subspecies Apis mellifera L. (Filogenetyka podgatunków Apis mellifera L.). Pchelovodstvo. V. 7. 2006. P. 18. (in Polish)  

Filogenetyka pszczół stoi dopiero u progu swego rozwoju i obecnie otwiera pole do dalszych badań. Końcowy obraz stosunków filogenetycznych pomiędzy podgatunkami pszczół winien być uzyskany tylko na podstawie analizy łącznej wszystkich materiałów gromadzonych w tym zakresie przez długi czas.
Gatunek A. mellifera L. zajmował areał naturalny obejmujący całą Afrykę i Europę, a także część Bliskiego Wschodu. Według F. Ruttnera (1992) gatunek dzieli się na 25 podgatunków. W.S. Sheppard i M.D. Meixner (2003) całkiem niedawno wykryli w górach Tien-szanu w Azji Środkowej jeszcze jeden podgatunek – A. m. pomonella. Wielość podgatunków wynika zapewne z izolacji i późniejszego nagromadzenia różnic genetycznych. W wyniku działania czynników antropogenicznych stale zachodzi intensywna hybrydyzacja podgatunków. Nastąpiła introdukcja różnych podgatunków A. mellifera do Ameryki Północnej i Południowej, Australii i Azji, co dało początek populacjom hybrydowym. Przypadkowo powstałe populacje pszczół zafrykanizowanych w Ameryce Południowej – potomkowie A. m. scutellata i zhybrydyzowanych podgatunków z Europy: A. m. mellifera, A. m. ligustica, A. m. carnica, A. m. caucasica i A. m. iberica (D.R. Smith, 1991) – stanowią poważne zagrożenie nie tylko dla ludności, ale także dla pszczelarstwa tego regionu.
W związku z wysokim poziomem integracji genomów różnych podgatunków, co jest skutkiem powszechnej introdukcji pszczół, filogenia A. mellifera jest niedopracowana. Przed kilku laty filogenetyka pszczół opierała się jedynie na badaniu morfometrii (F. Ruttner, 1992). Pierwsze kryteria dla systematyki wewnątrzgatunkowej A. mellifera zostały opracowane przez W.W. Ałpatowa (1948) i G. Goetzego (1940, 1964). Europejski system morfometryczny przybrał ostateczną postać po modyfikacji dokonanej przez F. Ruttnera (1978).
Według F. Ruttnera (1978), zgodnie z charakterystykami morfometrycznymi, gatunek A. mellifera L. dzieli się na cztery grupy: A, M, C i O (zob. tabela).
Grupie afrykańskiej podgatunków (grupa I) M.C. Ariasa i W.S. Shepparda (1996) odpowiada zaproponowana przez F. Ruttnera (1978) grupa A; grupie podgatunków Śródziemnomorza Północnego (grupa IV) – grupa C; A. m. mellifera (grupa III) – grupa M. Grupa IV odpowiada grupie C z wyłączeniem A. m. meda, która według F. Ruttnera (1988)
należy do grupy O. M.C. Arias i W.S. Sheppard (1996) potwierdzają analogię między grupą II a grupą O. Ich podobieństwo jednak jest tylko zewnętrzne, pod względem składu różnią się. Grupa O zawiera A. m. meda, ale nie zawiera A. m. lamarckii. Hipotezę spokrewnienia przez pochodzenie podgatunków z Bliskiego Wschodu i Afryki potwierdza skład grupy II, która łączy A. m. lamarckii z Egiptu i A. m. meda z Syrii.
Dwie próbki A. m. meda mieszczą się w różnych grupach: jedna razem z podgatunkami afrykańskimi, druga razem z północnośródziemnomorskimi. Potwierdza to hipotezę, że Bliski Wschód może być ośrodkiem pochodzenia gatunku (F. Ruttner, 1988; L. Garnery, 1992; M.C. Arias and W.S. Sheppard, 1996). Dodatkowe badanie podgatunków z Turcji, ze Śródziemnomorza Wschodniego i Kaukazu, takich jak A. m. anatoliaca i A. m. caucasica, pozwoli rozstrzygnąć kwestię pokrewieństwa podgatunków.
Badania A. Estoupa (1995) nad siedmioma loci mikrosatelitarnymi – A113, B124, A7, A24, A28, A88 i A43 – potwierdzają istnienie i skład trzech gałęzi ewolucyjnych: M, C i A, które zostały uprzednio wyróżnione przez F. Ruttnera (1978). Gałąź M jest reprezentowana przez trzy populacje z Avignon (Francja Południowa, A. m. mellifera), Valenciennes (Francja Północna, A. m. mellifera) i Umea (Szwecja, A. m. mellifera). Gałąź C jest reprezentowana przez populacje z Forli (Włochy, A. m. ligustica), Berlina (Niemcy, A. m. carnica) i Chalkidiki (Grecja, A. m. cecropia). Gałąź A reprezentują populacje z Johannesburga (Afryka Południowa, A. m. scutellata), Cape Town (Afryka Południowa, A. m. capensis) i Tinznitu (Maroko, A. m. intermissa) (zob. tabela).
Tabela porównawcza wyników badań filogenetycznych trzech autorów wykazuje, że u M.C. Arrias i W.S. Shepparda (1996) z 16 porównywanych podgatunków tylko osiem podgatunków odpowiada grupom F. Ruttnera (1988), a u A. Estoupa(1995) z siedmiu podgatunków – tylko sześć. Być może tłumaczy się to różnym znaczeniem ewolucyjnym loci zastosowanych w danym porównaniu. Każdy locus posiada własny współczynnik selekcji, co jest czynnikiem decydującym w ustalaniu częstotliwości alleli, która stanowi podstawę do określania stopnia spokrewnienia między porównywanymi podgatunkami.
Metody morfometryczne, pomimo swego znaczenia w badaniach filogenetycznych, przy osiągniętym obecnie poziomie hybrydyzacji podgatunków, a także wobec silnej zmienności cech, nie nadają się do stosowania w identyfikacji podgatunków (N.N. Grankin, 1997). Metody molekularno-genetyczne, przy całej swej precyzyjności, także nie mogą pretendować do doskonałości – ze względu na nierównomierność nagromadzenia mutacji, istnienie poziomego przenoszenia materiału genetycznego, niejednoznaczności procesów splicingu i częstotliwości stosowania kodonów (W.W. Grieczko, 2002; J.J. Jeśkow, 1995).
Metody morfometryczne nie mogą być stosowane odrębnie od molekularno-genetycznych, gdyż każda cecha morfometryczna na poziomie cząsteczkowym jest kodowana przez kilka genów, w tym strukturalnych i regulacyjnych, i zależy od przypadkowości mutacji w każdym z nich. Metody molekularno-genetyczne nie mogą wyprzeć metod morfometrycznych, ponieważ bezpośrednim punktem przyłożenia doboru naturalnego są fenotypy skorelowane z genotypami, ale nieodzwierciedlające ich bezpośrednio (L.P. Tatarinow, 1984). Jednak metody molekularno-genetyczne częściej pozwalają uzyskać jednoznaczne rezultaty. Na przykład identyfikacji podgatunków A. m. mellifera i A. m. caucasica dokonuje się według długości amplifikowanego fragmentu locusu międzygenowego COI-COII mtDNA (J.M. Nikonorow et al., 1998; A.G. Nikolenko i A.W. Poskriakow, 2002).
W taki sposób współczesne badania filogenetyczne prowadzi się z zastosowaniem metod zarówno morfologicznych, jak molekularno-genetycznych. Schematy pokrewieństwa
podgatunków zbudowane na podstawie korzystania z różnych metod wykazują określony stopień podobieństwa, gdy chodzi o liczbę grup, często jednak powstają rozbieżności co do składu każdej z nich. Jest to być może skutek różnego znaczenia ewolucyjnego i współczynnika selekcji loci oraz doboru próbek, które mogły okazać się hybrydowymi.
  120. Ильясов Р. А., Шареева З. В. Действие флувалината и амитраза на семью пчел. Пчеловодство. №6. 2014. С. 30-32  

Действие флувалината и амитраза на семью пчел (Effect of fluvalinate and amitraz on bee colony)
Экспериментально показано, что для лечения варроатоза наиболее оптимально использовать терапевтические дозы акарицидов на основе флувалината и амитраза. Превышение их в 1,5 раза при обработке от варроатоза способно ухудшить биологические и хозяйственно полезные признаки пчелиной семьи.
It is experimentally shown that the treatment varroatosis the best use of therapeutic doses of acaricides on the basis of amitraz and fluvalinate. Excess of 1.5 times in the processing of varroatosis can degrade biological and economically useful signs of the bee colony.
Publication Name: Ilyasov R.A., Shareeva Z.V. Effect of fluvalinate and amitraz on bee colony. Russian journal of beekeeping. V.6. 2014 P. 30-32.
  119. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Vitellogenin exons (E2, E3, E4, E5, E6, E7) polymorphisms in Ural population of honeybees Apis mellifera mellifera L. GenBank. 2014. accession numbers KJ532124-KJ532147, KJ572285-KJ572320, KJ645883-KJ645894 (http://www.ncbi.nlm.nih.gov).  

Apis mellifera mellifera isolate VgE7-01 vitellogenin (Vg) gene, exon 7 and partial cds
GenBank: KJ532124.1
FASTA Graphics PopSet
Go to:
 LOCUS       KJ532124                 461 bp    DNA     linear   INV 29-JUL-2014
DEFINITION  Apis mellifera mellifera isolate VgE7-01 vitellogenin (Vg) gene,
            exon 7 and partial cds.
ACCESSION   KJ532124
VERSION     KJ532124.1  GI:625295217
KEYWORDS    .
SOURCE      Apis mellifera mellifera (German honeybee)
  ORGANISM  Apis mellifera mellifera
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
            Aculeata; Apoidea; Apidae; Apis.
REFERENCE   1  (bases 1 to 461)
  AUTHORS   Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
  TITLE     Vitellogenin exons polymorphisms in Ural population of honeybees
            Apis mellifera melifera L.
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 461)
  AUTHORS   Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAR-2014) Ufa Scientific Center of Russian Academy of
            Sciences, Institute of Biochemistry and Genetics, Prospekt
            Oktyabrya, 71, Ufa, Bashkortostan 450054, Russia
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..461
                     /organism="Apis mellifera mellifera"
                     /mol_type="genomic DNA"
                     /isolate="VgE7-01"
                     /sub_species="mellifera"
                     /db_xref="taxon:44477"
                     /pop_variant="Kagarmanovo"
                     /country="Russia: Bashkortostan republic, Beloreckii
                     region"
                     /collection_date="01-Jul-2013"
                     /collected_by="Ilyasov R.A."
     gene            <1..>461
                     /gene="Vg"
     mRNA            <1..>461
                     /gene="Vg"
                     /product="vitellogenin"
     CDS             <1..>461
                     /gene="Vg"
                     /codon_start=1
                     /product="vitellogenin"
                     /protein_id="AHY24686.1"
                     /db_xref="GI:625295218"
                     /translation="FDHDSTNDFVGPKNCLFRKPEHFVASYALISNQCEGDSLNVAKS
                     LQDHDCIRQERTQQRNVISDSESGRLDTEMSTWGYHHNVNKHCMIHRTQVKETDDKIC
                     FTMRPVVSCASGCTAVETKSKPYKFHCMEKNEAAMKLKKRIEKGANPDLSQ"
     exon            <1..>461
                     /gene="Vg"
                     /number=7
ORIGIN      
        1 ttcgaccacg actcgaccaa cgatttcgtg ggacccaaga actgcctgtt cagaaagccc
       61 gaacacttcg tagccagcta cgctttgatc agtaatcaat gcgagggtga ctcgttgaac
      121 gtggcgaaat ctcttcagga tcacgattgc atccgacagg agaggaccca gcagagaaac
      181 gtgatcagcg acagcgaatc gggacgattg gacaccgaga tgtcgacctg gggttaccac
      241 cataacgtta acaaacattg catgatccac aggacccagg taaaggagac cgatgacaag
      301 atctgcttca ccatgcgtcc agtggtctct tgcgcgtctg gttgcaccgc tgtcgagacg
      361 aaatcgaagc cgtacaagtt ccattgcatg gagaagaacg aggccgcgat gaagctgaag
      421 aagagaatcg agaagggcgc caatcctgac ctcagccaga a
//
  118. Ильясов Р.А., Прощалыкин М.Ю., Поскряков А.В., Лелей А.С., Николенко А.Г. Популяция восковой пчелы Apis cerana F. в России. Проблемы и перспективы сохранения генофонда медоносных пчел в современных условиях: Материалы 1-й Международной научно-практической конференции, посвященной 145-летию со дня рождения М.А. Дернова (4-5 марта 2014 г.). Киров: НИИСХ Северо-Востока, 2014. С. 96-101.    

Сотрудники Института биохимии и генетики УНЦ РАН в Уфе в иссле- довательской работе использовали рабочих особей из 10 семей китайской восковой пчелы А. сегапа, предоставленные сотрудниками дальневосточного института почвоведения - Кузнецовым В.Н., Лелеем A.C., Прощалыкиным М.Ю на территории Хасанского района Приморского края. На основе срав- нительного кластерного анализа нуклеотидных последовательностей локуса COI (1 субъединицы цитохром оксидазы) мтДНК китайской восковой пчелы методом ближайшего соседа построили дендрограмму генетических отноше- ний А. сегапа разных популяций. На дендрограмме представители А. сегапа дальневосточной популяции кластеризуются в основном отдельно от пред- ставителей других популяций и подразделяется на 4 группы, где в 1 группу вошли пчелы с заповедника Кедровая Падь и п. Ромашка. Во 2 группу вошли представители п. Барабаш, п. Ромашка и с. Овчинниково. В 3 группу выделя- ется единственный представитель с п. Ромашка. Четвертая группа объединя- ет представителей пчел с Академгородка, заповедника Кедровая Падь и п. Ромашка и представителей приморской, корейской и японской популяций А.сегапа. Представители каждого вида пчел группируются отдельно. А.сегапа и A.nuluensis из Малайзии имеют очень большое генетическое сход- ство по сравнению с другими видами (Ильясов и др., 2013). В результате проведенных исследований в дальневосточной популяции восковой пчелы А.сегапа сотрудниками Института биохимии и генетики УНЦ РАН были выделены 4 генетические группы. Наибольшее генетическое сходство с другими азиатскими популяциями А.сегапа наблюдалось у пред- ставителей пчел из Академгородка, заповедника Кедровая Падь, п. Ромашка. Наибольшее генетическое разнообразие наблюдалось в популяции пчел 100 п. Ромашка, представители которой не группируются вместе в один кластер. Предполагается, что для успешного сохранения популяции восковой пчелы в России необходимо наличие максимально допустимого уровня генетического разнообразия. Employees of the Institute of Biochemistry and Genetics, Ufa Science in Ufa in the study We used dovatelskoy working individuals from 10 families of Chinese A bee wax segapa provided by employees of the Far Eastern Institute of Soil Science - Kuznetsov VN, Lele AC, Proshchalykin M.Yu. the territory of Khasan district of Primorye Territory. On the basis of comparison enforcement of cluster analysis of nucleotide sequences of the locus COI (cytochrome oxidase subunit 1) mtDNA Apis cerana by nearest neighbor built a dendrogram of genetic relations tions A. segapa different populations. In the dendrogram representatives A. segapa Far Eastern populations clustered mostly separately from representatives tives and other populations are divided into 4 groups, where one group Bees came to Cedar Pad Reserve and n. Chamomile. In the 2nd group included n representatives. Barabash, p. Chamomile and. Ovchinnikov. In group 3 was isolated It is the only representative from the claim. Chamomile. The fourth group were combined a bee with representatives of Akademgorodok, Cedar Pad Reserve and n. Chamomile and representatives of the seaside, Korean and Japanese populations A.segapa. Representatives of each species of bees are grouped separately. A.segapa A.nuluensis and Malaysia have a very high genetic similarity GUSTs compared to other species (Ilyasov et al., 2013). The studies in the Far Eastern population bees wax A.segapa the Institute of Biochemistry and Genetics USC RAS allocated 4 genetic groups. The largest genetic similarity with other Asian populations A.segapa observed in pre- sentatives bees from Akademgorodok, reserve Cedar Pad, p. Chamomile. The greatest genetic diversity was observed in the population of bees 100 n. Chamomile, whose members are not grouped together in a single cluster. It is expected that the successful conservation of the population in bee wax Russia must have the maximum level of genetic diversity. 
  117. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Fragment of tRNALeu-COII sequences from mtDNA of bees from Bashkortostan republic of Russia. GenBank. 2014. accession numbers KF970918-KF970925 (http://www.ncbi.nlm.nih.gov).  

  Apis mellifera voucher 3513 tRNA-Leu (trnL) gene, partial sequence; tRNALeu-
COII intergenic spacer, complete sequence; and cytochrome oxidase
subunit II (COII) gene, partial cds; mitochondrial
GenBank: KF970918.1
FASTA Graphics PopSet
Go to:
 Next record
LOCUS KF970918 540 bp DNA linear INV 25-FEB-2014
DEFINITION Apis mellifera voucher 3513 tRNA-Leu (trnL) gene, partial sequence;
tRNA-Leu-COII intergenic spacer, complete sequence; and cytochrome
oxidase subunit II (COII) gene, partial cds; mitochondrial.
ACCESSION KF970918
VERSION KF970918.1 GI:586619662
KEYWORDS .
SOURCE mitochondrion Apis mellifera (honey bee)
ORGANISM Apis mellifera
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
Aculeata; Apoidea; Apidae; Apis.
REFERENCE 1 (bases 1 to 540)
AUTHORS Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
TITLE Fragment of tRNALeu-COII sequences from mtDNA of bees from
Bashkortostan republic of Russia
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 540)
AUTHORS Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
TITLE Direct Submission
JOURNAL Submitted (16-DEC-2013) Ufa Scientific Center of Russian Academy of
Sciences, Institute of Biochemistry and Genetics, Prospekt
Oktyabrya, 71, Ufa, Bashkortostan 450054, Russia
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..540
/organism="Apis mellifera"
/organelle="mitochondrion"
/mol_type="genomic DNA"
/isolation_source="Birskii Osinovka Chernikov Q"
/specimen_voucher="3513"
/db_xref="taxon:7460"
/country="Russia"
/collection_date="01-Jun-2012"
/collected_by="R.A.Ilyasov"
/PCR_primers="fwd_name: e2, fwd_seq: ggcagaataagtgcattg,
rev_name: h2, rev_seq: caatatcattgatgacc"
gene <1..37
/gene="trnL"
/note="tRNA-Leu"
misc_feature 38..238
/note="tRNA-Leu-COII intergenic spacer"
gene 239..>540
/gene="COII"
CDS 239..>540
/gene="COII"
/codon_start=1
/transl_table=5
/product="cytochrome oxidase subunit II"
/protein_id="AHJ78623.1"
/db_xref="GI:586619663"
/translation="MSTWFMFMFQESNSYYADNLISFHNMVMMIIIMISTLTVYIILD
LFMNKFSNLFLLKNHNIEIIWTIIPIIILLIICFPSLKILYLIDEIVNPFFSIKSIG"
ORIGIN
1 tgaacttaag attcaaatat aaagtatttt taaactttta ttaaaatttc ccacttaatt
61 catattaatt taaaaataaa ttaataacaa tttttaataa aataaataat taattttatt
121 tttatattga attttaaatt caatcttaaa gatttaatct ttttattaaa attaataaat
181 taatataaaa taaaacaaaa tataacagaa tatatttatt aaaatttaat ttattaaaat
241 ttccacatga tttatattta tatttcaaga atcaaattca tattatgctg ataatttaat
301 ttcatttcat aatatagtta taataattat tattataatt tcaacattaa ctgtatatat
361 tattttagat ttatttataa acaaattctc aaatttattt ttattaaaaa atcataatat
421 tgaaattatt tgaacaatta ttccaattat tattctatta attatttgtt ttccatcatt
481 aaaaatttta tatttaattg atgaaattgt aaatcctttt ttttcaatta aatcaattgg
//
  116. Николенко А.Г., Ильясов Р.А., Поскряков А.В., Кугейко В.О. Опыт молекулярно-генетической сертификации пасеки. Пчеловодство. №5. 2013. С. 14-15.  

Опыт молекулярно-генетической сертификации пасеки (Experience in the molecular genetics in certification of apiary) Приведен опыт молекулярно-генетической сертификации племенной пасеки и отбора лучших семей для дальнейшей племенной работы и получения высококачественных чистопородных среднерусских маток и пчелиных пакетов. The experience of molecular genetic certification apiary breeding and selection of the best families for further breeding and producing high-quality purebred Central Russian bee queens and packages. Publication Name: Nikolenko A.G., Ilyasov R.A., Poskryakov A.V., Kugeiko V.O. Experience in the molecular genetics in certification of apiary. Russian journal of beekeeping. V.5. 2013 P. 14-15. 
  115. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Unusual COI-COII intergenic sequences from mtDNA of bees from Udmurtiya republicGenBank. 2007. accession numbers EF676102-EF676104 (http://www.ncbi.nlm.nih.gov).

EF676102 Apis mellifera mellifera COI-COII intergenic spacer, partial sequence; mitochondrial
GenBank: EF676102.1
FASTA Graphics PopSet Go to:
LOCUS
DEFINITION
ACCESSION
VERSION
KEYWORDS
SOURCE
ORGANISM
REFERENCE
AUTHORS
TITLE
JOURNAL
REFERENCE
AUTHORS
TITLE
JOURNAL
FEATURES
source
misc feature
EF67 6102 566 bp DNA linear INV 04-AUG-2007
Apis mellifera mellifera COI-COII intergenic spacer, partial sequence; mitochondrial.
EF676102
EF67 6102.1 GI:154183615
mitochondrion Apis mellifera mellifera (German honeybee)
Apis mellifera mellifera
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
Aculeata; Apoidea; Apidae; Apis.
1 (bases 1 to 566)
Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
Unusual COI-COII intergenic sequences from mtDNA of bees from
Udmurtiya republic
Unpublished
2 (bases 1 to 566)
Ilyasov,R.A., Baymiev,A.K., Poskryakov,A.V. and Nikolenko,A.G. Direct Submission
Submitted (14-JUN-2007) Ufa Scientific Center, Institute of Biochemistry and Genetics, Prospekt Oktabrya, Ufa, Bashkortostan 450054, Russia
Location/Qualifiers
1..566
/organism="Apis mellifera mellifera" /organelle="mitochondrion"
/mol type="genomic DNA"
/sub species="mellifera"
/db xref="taxon:44477"
/dev stage="adult"
/country="Russia: Udmurtiya republic, Malo-Purginskii region"
/collected by="Ilyasov R. A."
/PCR primers="fwd seq: cacatttagaaattccatta, rev seq: ataaatataaatcatgtgga"
<1..>566
/note="COI-COII intergenic spacer"
ORIGIN
//
1 aattttaatt accttttaat atggcagaat aagtgcattg aacttaagat tcaaatataa
61 agtatttttt aacttttatt aaaattaaca aattaatata aaatatgaat tatatttatt
121 aaaatttaat ttattaaaat tttccactta attcatttta atttaaaaat ataattaaat
181 aacaattttt aataaaataa ataattaatt ttatttttat attgaatttt aaattcaatc
241 ttaaagattt aatcttttta ttaaaattaa taaattaata taaaaaataa aacaaaatat
301 aacgaaatat atttattaaa atttaattta ttaaaatttc ccacttaatt cattttaatt
361 taaaaataaa ttaaataacg atttttaata aaataaataa ttaattttat ttttatattg
421 aattttaaat tcaatcttaa agatttaatc tttttattaa aactagtaaa ttaatataaa
481 aaataaaacc aaatgtagca aagtgtgttt gttaaaattt aatttattaa aatttcccac
541 gtagttcatt ttaatttaaa gagaag
  114. Ильясов Р. А., Гайфуллина Л. Р., Салтыкова Е. С., Поскряков А. В., Николенко А. Г. Методы диагностики, профилактики и лечения нозематоза классического и типа С. Пчеловодство. 2013. № 10. С. 30-32.  

Методы диагностики, профилактики и лечения нозематоза классического и типа С (Methods of diagnosis, prevention and treatment of classical type of nosema and of type C) В последние десятилетия классический нозематоз, вызываемый Nosema apis, активно вытесняется более опасным нозематозом типа С, вызываемым Nosema ceranae. Основная опасность заключается в длительном бессимптомном латентном периоде и резком увеличении численности патогена за небольшой промежуток времени вне зависимости от сезона года, что может привести к гибели пчелиной семьи. Ранняя диагностика и лечение нозематоза типа С повышают шансы на сохранение жизни и здоровья пчел. In recent decades, the classic nosema, called Nosema apis, actively displaced more nosema dangerous type C caused Nosema ceranae. The main danger lies in the long-term asymptomatic latent period and a sharp increase in the number of the pathogen within a short period time, regardless of the season, which may lead to the death of bees. Early diagnosis and treatment of nosema disease type C increase the chances of the preservation of life and health of the bees. Publication Name: Ilyasov R.A., Gaifullina L.R., Saltykov E.S., Poskryakov A.V., Nikolenko A.G. Methods of diagnosis, prevention and treatment of classical type of nosema and of type C. Russian journal of beekeeping. 2013. V.10. P. 30-32. 
  113. Ильясов Р. А., Гайфуллина Л. Р., Салтыкова Е. С., Поскряков А. В., Николенко А. Г. Роль антимикробного пептида дефенсина в иммунитете пчелиной семьи. Пчеловодство. №1. 2014. С. 26-28.

Роль антимикробного пептида дефенсина в иммунитете пчелиной семьи (Role of antimicrobial peptide defensin in the immunity of the bee colonies) Дефенсины индуцибельны, контролируются взаимодействием Toll- и Imd-сигнальных путей и обладают широким спектром антимикробного действия. Они существуют в виде двух пептидов — дефенсин 1 и 2. Первый синтезируется в слюнных железах и участвует в формировании общественного иммунитета, тогда как второй синтезируется клетками жирового тела и гемолимфы, являясь фактором индивидуального иммунитета медоносной пчелы. Defensins inducible, controlled interaction Toll- and Imd-signaling pathways and have broad spectrum antimicrobial activity. they Are exist as two peptides - defensin 1 and 2. First synthesized in the salivary glands and is involved in forming public immunity, whereas the second is synthesized by cells of the fat body and hemolymph, being a factor of individual immunity honeybee. Publication Name: Ilyasov R.A., Gaifullina L.R., Saltykov E.S., Poskryakov A.V., Nikolenko A.G. Role of antimicrobial peptide defensin in the immunity of the bee colonies. Russian journal of beekeeping. V.1. 2014 P. 26-28. 
  112. Ильясов Р.А., Прощалыкин М.Ю., Поскряков А.В., Лелей А.С., Николенко А.Г. Сохранение восковой пчелы А.cerana на Дальнем Востоке. Пчеловодство. 2013. № 9. С. 56-57.  

Сохранение восковой пчелы А.cerana на Дальнем Востоке (Saving of the wax bees A.cerana at the Far East)
В дальневосточной популяции восковой пчелы A.cerana мы обнаружили 4 группы. Наибольшее генетическое сходство
с другими азиатскими особями наблюдалось у представителей пчел из Академгородка, за поведника Кедровая Падь, п. Ромашка. Наибольшее генетическое разнообразие наблюдалось в популяции пчел п. Ромашка, представители которой не группируются вместе в один кластер. Отметим, что для сохранения полноценной популяции восковой пчелы в России необходимо сохранить представителей всех четырех генетических групп.
In the Far Eastern populations bees wax A.cerana we found 4 groups. The highest genetic similarity
with other Asian individuals was observed in bees representatives of Akademgorodok, for the preacher Cedar Pad, p. Chamomile. The greatest genetic diversity was observed in the population of bees p. Chamomile, whose members are not grouped together in one cluster. Note that to preserve the full population of bees wax in Russia is necessary to keep all four genetic groups.
Publication Name: Ilyasov R.A., Proshchalykin M.Y., Poskryakov A.V., Lelei A.C., Nikolenko A.G. Saving of the wax bees A.cerana at the Far East. Russian journal of beekeeping. 2013. V. 9. P. 56-57.
  111. Ильясов Р.А., Прощалыкин М.Ю., Поскряков А.В., Лелей А.С., Николенко А.Г. Генетическая структура популяции китайской восковой пчелы Apis cerana Fabricius, 1793 на Дальнем Востоке России. Материалы всероссийской научной конференции «Современные проблемы биохимии и биотехнологии». Уфа. 25-27 сентября 2013. С. 29-32.

В работе были использованы рабочие особи китайской восковой пчелы A.cerana собранные сотрудниками дальневосточного института почвоведения - Кузнецовым В.Н., Лелеем А.С., Прощалыкиным М.Ю. Полимеразную цепную реакцию проводили с универсальными праймерами для локуса COI мтДНК F-LCO1490 (5'-GGTCAACAAATCATAAGATATTGG-3') и R-LCO2198 (5'-TAACTTCAGGGTGACCAAAAAATCA-3') [Folmer et al., 1994], продукты которой были просеквенированы. На основе сравнительного кластерного анализа нуклеотидных последовательностей локуса COI мтДНК китайской восковой пчелы методом ближайшего соседа была построена дендрограмма генетических отношений A.cerana разных популяций. На дендрограмме представители A.cerana дальневосточной популяции кластеризуются в основном отдельно от представителей других популяций и подразделяется на 4 группы, где в 1 группу вошли пчелы с заповедника Кедровая Падь и п. Ромашка. Во 2 группу вошли представители п. Барабаш, п. Ромашка и с. Овчинниково. В 3 группу выделяется единственный представитель с п. Ромашка. Четвертая группа объединяет представителей пчел с Академгородка, заповедника Кедровая Падь, п. Ромашка и представителей приморской, корейской и японской популяций A.cerana. Представители каждого вида пчел группируются отдельно. A.cerana и A.nuluensis из Малайзии имеют очень большое генетическое сходство по сравнению с другими видами. Таким образом, в дальневосточной популяции восковой пчелы A.cerana мы обнаружили 4 генетические группы. Наибольшее генетическое сходство с другими азиатскими популяциями A.cerana наблюдалось у представителей пчел из Академгородка, заповедника Кедровая Падь, п. Ромашка. Наибольшее генетическое разнообразие наблюдалось в популяции пчел п. Ромашка, представители которой не группируются вместе в один кластер. Для сохранения полноценной популяции восковой пчелы в России необходимо сохранить представителей всех четырех генетических групп. We used individual workers Apis cerana A.cerana collected by the staff of the Far Eastern Institute of Soil Science - Kuznetsov VN, Lele AS, Proshchalykin MU Polymerase chain reaction was performed with universal primers locus COI mtDNA F-LCO1490 (5'-GGTCAACAAATCATAAGATATTGG-3 ') and R-LCO2198 (5'-TAACTTCAGGGTGACCAAAAAATCA-3 ') [Folmer et al., 1994] which products were sequenced. Based on comparative cluster analysis of nucleotide mtDNA COI sequences locus Apis cerana by the nearest neighbor was constructed dendrogram of genetic relationship A.cerana different populations. In the dendrogram representatives A.cerana Far Eastern populations clustered in substantially separate from members of other populations and divided into 4 groups, where 1 group consisted of bees reserve Cedar Pad and n. Chamomile. In the 2nd group included n representatives. Barabash, p. Chamomile and. Ovchinnikov. The band released 3 the only representative of a claim. Chamomile. The fourth group comprises representatives bees Akademgorodok reserve Cedar Pad, p. Chamomile and representatives seaside, Korean and Japanese populations A.cerana. Representatives of each species of bees grouped separately. A.cerana A.nuluensis and Malaysia have a very large genetic similarity when compared with other species. Thus, in the Far Eastern populations bee wax we A.cerana We found four genetic groups. The largest genetic similarity with other Asian populations A.cerana observed among representatives of bees from Akademgorodok, reserve Cedar Pad, p. Chamomile. The greatest genetic diversity observed in the bee population n. Chamomile, whose members are not grouped together of one cluster. To preserve the full population of bees wax in Russia you need to save all four genetic groups. 
  110. Ilyasov R.A., Gaifullina L.R., Saltykova E.S., Poskryakov A.V., Nikolenko A.G. Defensins in the Honeybee Antiinfectious Protection. Journal of Evolutionary Biochemistry and Physiology, 2013, Vol. 49, No. 1, pp. 1—9.  

Defensins in the Honeybee Antiinfectious Protection Specific conditions of the honeybee life honeybee life require the presence of effective mechanisms of antiinfectious protection whose one of the most important components are defensins—the family of antimicrobial peptides. In the honeybee, defensins are present in the form of two different peptides—defensin 1 and 2 that are similar between each other only by 55.8%. Defensin 1 synthesized in salivary glands plays an important role in social immunity, whereas defensin 2 synthesized by cells of fat body and lymph is an important factor in the system of the honeybee individual immunity. Defensins are inducible, are controlled by interaction of Toll and Imd signal pathways and have a large specter of antimicrobial action. Publication Name: Ilyasov R.A., Gaifullina L.R., Saltykova E.S., Poskryakov A.V., Nikolaenko A.G. Defensins in the Honeybee Antiinfectious Protection. Journal of Evolutionary Biochemistry and Physiology, 2013, V. 49 (1), P. 1-9. 
  109. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Conservation of Ural population of Apis mellifera mellifera. International conference SICAMM 2012. Landquart, Switzerland, 31 August - 4 September 2012. P. 26-27.

Ap is mellifera has an extraordinary huge natural area of distribution spanning from Southern Scandinavia in the North to the Cape of Good Hope in the South; from Dakar in the West to Altai, the Oman coast and western borders of China in the East (Ruttner et a l., 1988; Sheppard, Meixner, 2003). It has been shown that different types of honeybees in all occupied territory are subspecies and are capable to be crossed among each others and give prolific descendants. Due to long geographical isolation and ecological adaptation there is a deep differentiation of honeybees what led to a big diversity of subspecies. In Bashkortostan republic there is very hard problem of conservations of aboriginal bee subspecies A.m.mellifera. For conservations it is necessary identification hybrid families families, to eliminate their further distribution. Intergenic locus COI-COII of mtDNA varying among bees subspecies. There are the genetic markers of this locus allowing identify of hybrid origin bees colonies, in particular hybridization with bees from Caucasus (A.m.caucasica and A.m.armeniaca). In Bashkortostan republic we shown existence pool of the saved aboriginal bees in the north of republic on territory of several districts (Tatyshlynskii, Yanaulskii, Birskii, Karaidelski, Mishkinskii, Ishimbaiskii, Buraevskii and Ask in sk ii) and in the south of republic on territory of Burzyan district. We studied populations of bees on territory of several regions of Ural and Volga region. Large populations of bees A.m.mellifera on our researches was saved on territory of Permski oblast, Bashkortostan republic and republic Udmurtiya. The higher degree of hybridization is observed in bee population on territory of the Chelyabynski and Sverdlovski oblast. On the basis of the conducted researches it is already possible to make the map of geographical distribution of natural area of aboriginal bee A.m.mellifera. Our researches have shown that among hybrid honeybees at least four local populations of Dark European Honeybees A.m.mellifera were saved in Urals (Ilyasov et al., 20 06 ; Ilyasov et al., 2007). This research has show phylogenetics relationship of Russian and European populations of A.m.mellifera. Genetic relatedness of A .m.mellifera populations we show using 8 microsatellite locuses, in particular microsatellites ap243, 4 a1 10, ap049, a113, a43, a8, a8 8, a28. On the grouping of population influences both community of their origin and their geographical location in relation to each other. Cluster analysis was conducted using neighbour joining method. On built dendrogram Bee population of Iglinski district grouping separately from other populations of Bashkortostan republic. On dendrogram bee populations of different regions (Bashkortostan republic, Permski oblast, republic Udmurtiya and Sverdlovskaya oblast) population of bees of Sverdlovskaya oblast is disposed separately. Such separate location of bees population of Iglinskii district of Bashkortostan republic and Sverdlovskaya oblast is explained by their hybrid origin. Our laboratory plans to extend genetic researches of bees populations on all territory of Russia. 
  108. Ильясов Р.А., Макаров В.Л., Поскряков А.В., Николенко А.Г. Популяционная характеристика среднеуральской медоносной пчелы. Тезисы докладов всероссийской молодежной конференции «Актуальные проблемы генетики и молекулярной биологии». Уфа. 2012. С. 33-34.  

Среднерусская пчела занимает широкий ареал обитания. В настоящее время по всему ареалу среднерусских пчёл преобладают гибриды разных рас пчёл. Пермский край является северной границей естественного обитания всего вида Apis meliifera. Целью настоящего исследования являлось продолжение изучения структуры популяции медоносной пчелы Пермского края.
Результаты морфометрического анализа показали, что исследованные пчёлы соответствуют стандарту среднерусской расы. Особенностью является низкий кубитальный индекс.
Результаты молекулярно-генетического анализа по локусу COI-COII мтДНК свидетельствуют об отсутствии значительной генетической дифференциации пчёл Пермского края и единстве происхождения популяции по материнской линии от пчел среднерусской расы, аборигенной для Северной Евразии.
Central Russian bee takes a habitat. At present the entire range of the Central Russian bees dominated hybrids of different races of bees. Perm region is the northern boundary of the natural habitat of the species Apis meliifera. The purpose of this study was to study the structure of the continuation of the honey bee population of the Perm region.
The results of morphometric analysis showed that the studied bees meet the standard of Central race. A special feature is the low cubital index.
The results of the molecular genetic analysis of locus COI-COII mtDNA showed no significant genetic differentiation bees Perm region and the unity of the origin of the population through the maternal line of the Central Russian bee race, native to northern Eurasia.
  107. Ильясов Р.А., Макаров В.Л., Поскряков А.В., Николенко А.Г. Популяционная характеристика среднеуральской медоносной пчелы. Материалы всероссийской молодежной конференции «Актуальные проблемы генетики и молекулярной биологии». Уфа. 2012. С. 155-158.  

ПОПУЛЯЦИОННАЯ ХАРАКТЕРИСТИКА СРЕДНЕУРАЛЬСКОЙ МЕДОНОСНОЙ ПЧЕЛЫ
Ключевые есть: Среднерусская пчела, ДНК-маркирование,
митохондриальная ДНК, марфометрия, популяция
Среднерусская пчела занимает широкий ареал обитания. В настоящее время по всему ареалу среднерусских пчёл преобладают гибриды разных рас пчёл. Пермский край является северной границей естественного обитания всего вида Apis mellifera L. Ранее установлено (Петухов, 1996; Ильясов и др., 2006), что аборигенная популяция медоносной пчелы неоднородна - есть пасеки как с чистопородными, так и с гибридными пчелиными семьями.
Целью настоящего исследования являлось продолжение изучения структуры популяции медоносной пчелы Пермского края. Для этого определяли:
1. морфометрические признаки рабочих пчёл по общепринятой методике (Билаш, Кривцов, 1991);
2. кубитальный индекс крыла рабочих пчёл в программе CooRecorder;
3. полиморфизм локуса С01-С0П митохондриальной ДНК, что является генетическим маркером расовой принадлежности пчел (Николенко и др., 2002).
Для исследования расовой принадлежности, а также для определения и оценки степени гибридизации, были исследованы десять пасек из разных районов Пермского края (Табл. 1).
Препарированные хитиновые части тела пчёл приклеивали с помощью канцелярского клеящего карандаша на бумагу и ламинировали. Часть измерений производили с помощью окуляр-микрометра на бинокуляре МБС-9. Крылья сканировали и в программе CooRecorder по кубитальному индексу определяли расовую принадлежность исследуемых пчёл. Стандартными значениями кубитального индекса среднерусских пчёл считается 60-65%, или меньше 1,7 по европейским стандартам. Для пчёл южных рас характерен индекс меньше 60%, или больше или равно 1,7.
Полученные значения морфометрических признаков по разведенческим пасекам приведены в таблице 2. В результате установлено, что исследованные пчёлы по всем признакам, кроме кубитального индекса, соответствуют среднерусским пчёлам A.m.mellifera.
занесены в сводную таблицу 3, при этом пасеки распределены в две группы - чистопородных (куб. инд.< 1,7) и гибридных (куб. инд.> 1,7).
Результаты морфометрического анализа и частоты вариантов полиморфного локуса COI - СОИ мтДНК совместно с породными стандартами для среднерусской и серой горной кавказской пчёл приведены в таблице 4.
Для среднерусской пчелы A.m.mellifera характерны варианты PQ, PQQ, PQQQ межгенного локуса COI-COII мтДНК по материнской линии. Пчелы, собранные с пасек Пермского края, характеризовались довольно высоким уровнем частоты встречаемости комбинаций PQQ мтДНК. По подсчетам частот встречаемости аллелей у всех исследованных пчёл доля варианта PQQ выше
0,9, что является показателем их принадлежности по происхождению к среднерусским пчелам в 90 % случаях.
Выводы
1. Результаты морфометрического анализа показали, что исследованные пчёлы соответствуют стандарту среднерусской расы. Особенностью является низкий кубитальный индекс.
2. Результаты молекулярно-генетического анализа по локусу COI-COII мтДНК свидетельствуют об отсутствии значительной генетической дифференциации пчёл Пермского края и единстве происхождения популяции по материнской линии от пчел среднерусской расы, аборигенной для Северной Евразии.
Population characteristics Sredneuralskaya Honeybees
The key is: Central Russian bee, DNA labeling,
Mitochondrial DNA marfometriya, population
Central Russian bee takes a habitat. At present the entire range of the Central Russian bees dominated hybrids of different races of bees. Perm region is the northern boundary of the natural habitat of the species Apis mellifera L. previously established (Petukhov, 1996; Ilyasov et al., 2006) that the aboriginal populations of the honey bee is not uniform - there apiary both purebred and hybrid bee colonies.
The purpose of this study was to study the structure of the continuation of the honey bee population of the Perm region. To do this, define:
1. morphometric signs of working bees on the conventional method (Bilash, Krivtsov, 1991);
2. cubital index wing working bees in the program CooRecorder;
3. polymorphism loci C01-S0P mitochondrial DNA, which is a genetic marker race of bees (Nikolenko et al., 2002).
To study the race, as well as to identify and assess the degree of hybridization were investigated ten apiaries from different areas of the Perm Territory (Table. 1).
Dissected chitin body bees stuck using paper glue stick on paper and laminated. Some measurements were made using ocular micrometer on a binocular microscope MBS-9. The wings were scanned and the program CooRecorder cubital index was measured on race studied bees. The standard values ​​of cubital index Central Russian bees considered 60-65%, or less than 1.7 according to European standards. For southern bees races characteristic index less than 60%, or greater than or equal to 1.7.
The values ​​obtained for morphometric characters razvedencheskim apiaries are shown in Table 2. As a result, found that the bees studied by all indications, except for cubital index corresponding Srednerussky bees Ammellifera.
listed in the summary table 3, with the apiary divided into two groups - purebred (cu. Ind. <1.7) and hybrid (cu. Ind.> 1.7).
The results of morphometric analysis and frequency variants polymorphic locus COI - SDI mtDNA together with standards for the breed of Central and gray mountain Caucasian bees are shown in Table 4.
For the Central Russian bees Ammellifera characterized options PQ, PQQ, PQQQ intergenic locus COI-COII maternal mtDNA. Bees collected from apiaries in the Perm region, characterized by a fairly high frequency of combinations PQQ mtDNA. According to estimates of the frequency of alleles in all studied the bees share options above PQQ
0.9, which is an indication of their belonging by birth to the Srednerussky bees in 90% of cases.
Findings
1. The results of morphometric analysis showed that the studied bees meet the standard of Central race. A special feature is the low cubital index.
2. The results of the molecular genetic analysis of locus COI-COII mtDNA showed no significant genetic differentiation bees Perm region and the unity of the origin of the population through the maternal line of the Central Russian bee race, native to northern Eurasia.
  106. Ильясов Р.А., Поскряков А.В, Николенко А.Г., Брандорф А.З., Ивойлова М.М. Генетический и фенотипический анализ генофонда популяции Apis mellifera L. в Кировской области. Биомика. 2012. Т.3. № 1. С. 47-49.

Интродукции медоносных пчёл из отдаленных регионов началась более ста лет назад, с переходом от колодного к рамочному содержанию пчелиных семей. Согласно некоторых исследований, на территории Кировской области количество пчелиных семей среднерусской расы сохранилось не более 8% (ссылка). Данная ситуация является результатом массовой пропаганды и интродукции на территорию области пчелиных маток и пакетов карпатской (А. т. carpatica), серой горной кавказской (A. m.caucasica Gorb.), а в некоторые годы краинской (А. т. carnica), итальянской (А. т. ligustica Spin.) расы и даже дальневосточных пчёл.
По результатам расчёта коэффициента дифференциации между популяциями, кроме Кильмезской, отмечены значения близкие к нулю, что свидетельствует о низком уровне генетической дифференциации популяций (Fst=-0,154-0,057). Только в Кильмезской локальной популяции данный показатель составил Fst-0,202, при отрицательном коэффициенте инбридинга субпопуляций (Fit=-0,149), что является показателем аутбридинга, и может свидетельствовать об подержании биоразнообразия на высоком уровне, в связи с чем, данную популяцию можно рассматривать как источник поддержания генетического разнообразия медоносных пчёл А. т. mellifera.
Introduction of honey bees from remote regions began more than a hundred years ago, with the transition from Kolodny to the framework content of bee colonies. According to some studies, in the territory of the Kirov region number of bee colonies of Central race survived no more than 8% (link). This situation is the result of mass propaganda and introduction to the region of queen bees and packages Carpathian (A. m. Carpatica), gray mountain Caucasian (A. m.caucasica Gorb.), And in some years Krajina (A. m. Carnica), Italian (A. m. ligustica Spin.) Far Eastern races and even bees.
As a result of the calculation coefficient  of differentiation between populations, except Kilmezskoy, marked values ​​close to zero, which indicates a low level of genetic differentiation of populations (Fst = -0,154-0,057). Only Kilmezskoy local population the figure was Fst-0,202, with a negative coefficient of inbreeding subpopulations (Fit = -0,149), which is an indicator of outbreeding, and may be indicative of biodiversity used at a high level, and therefore, this population can be viewed as a source of maintain the genetic diversity of honey bees A. m. mellifera.
  105. Симанков М.К., Макаров В.Л., Симанков В.М., Ильясов Р.А., Поскряков А.В., Николенко А.Г. Морфогенетическая характеристика медоносной пчелы Пермского края. Материалы третьего международного форума пчеловодов «Медовый мир». Ярославль. 2012. С. 55-58.

Среднерусская пчела занимает широкий ареал обитания. В настоящее время по всему ареалу среднерусских пчёл преобладают гибриды разных рас пчёл. Пермский край является северной границей естественного обитания всего вида Apis mellifera L. Ранее установлено (Петухов, 1996; Ильясов и др., 2006), что аборигенная  популяция медоносной пчелы неоднородна – есть пасеки как с чистопородными, так и с гибридными пчелиными семьями.
Целью настоящего исследования являлось продолжение изучения структуры популяции медоносной пчелы Пермского края. Для этого определяли:
1.    морфометрические признаки рабочих пчёл по общепринятой методике (Билаш, Кривцов, 1991);
2.    кубитальный индекс крыла рабочих пчёл в программе CooRecorder;
3.    полиморфизм локуса COI-COII митохондриальной ДНК, что является генетическим маркером расовой принадлежности пчел (Николенко и др., 2002).
Для исследования расовой принадлежности, а также для определения и оценки степени гибридизации, были исследованы десять пасек из разных районов Пермского края (табл. 1).
Для анализа морфометрических признаков на каждой пасеке были исследованы до 10% пчелосемей. В сентябре отбирали по 25 особей от анализируемой семьи, помещали в картонные емкости и замораживали. Для исследования кубитального индекса и проведения генетического анализа с каждой пасеки отбирали по 100 пчёл и фиксировали их в 96% этаноле.
Материалы и методы
Техника препарирования частей тела пчелы
Обработка пчел, техника препарирования частей тела, измерение линейных признаков производилось в соответствии рекомендациями Г.Д. Билаша, Н.И. Кривцова (1991) и ВНИИ Пчеловодства. Отпрепарированные хитиновые части тела пчёл приклеивали с помощью канцелярского клеящего карандаша на бумагу и ламинировали. Часть измерений производили с помощью окуляр-микрометра на бинокуляре МБС-9. Крылья сканировали и в программе CooRecorder по кубитальному индексу определяли расовую принадлежность исследуемых пчёл. Стандартными значениями кубитального индекса среднерусских пчёл считается 60-65%, или 1,7 по европейским стандартам. Для пчёл южных рас характерен индекс меньше 60%, или больше 1,7. Информативную картину даёт графическое представление, в виде вариационных кривых, значений кубитального индекса.
В комплексе морфометрических исследований использовали длину хоботка, длину и ширину правого переднего крыла, его кубитальный индекс, длину и ширину четвертого тергита.
Всего исследовано 1600 особей пчел с 98 пчелиных семей с 10 пасек, изготовлено 2800 препаратов, произведено 8400 измерений с помощью окуляр-микрометра на бинокуляре МБС-9.
Методика проведения генетического анализа
Исследования по генетическому анализу проводилась совместно с Р.А. Ильясовым, А.В. Поскряковым и А.Г. Николенко из Института биохимии и генетики Уфимского научного центра РАН. Основу генетического анализа составил установленный ранее полиморфизм межгенного локуса COI-COII у представителей разных подвидов медоносной пчелы Apis mellifera. Установлено, что протяженный АТ-богатый межгенный участок мтДНК., локализованный между генами COI и COII и не кодирующий аминокислотной последовательности, может быть использован в качестве маркера для различения подвидов Apis mellifera mellifera (пчела среднерусской расы) и A.m.caucasica (серая горная кавказская пчела) благодаря вариабельности длины, обусловленной различным соотношением элементов Р и Q, где межгенный участок у представителей ветви М (A.m.mellifera), аборигенных для Пермского края, имеет комбинацию PQQ, тогда как у представителей ветви С (A.m.caucasica, A.m.camica, A.m.ligustica), гибридизация с которыми наблюдается на территории Пермского края, имеется единственный элемент Q. Таким образом, межгенный локус COI-COII мтДНК у представителей эволюционной ветви С и их гибридов по материнской линии на 268 п.н. короче межгенного локуса COI-COII мтДНК у представителей ветви М, и эти локусы легко разделяются при электрофорезе. Размер продукта ПЦР межгенного локуса COI-COII мтДНК, включающий и ген тРНКLeu у представителей A.m.mellifera, равен примерно 600 п.н., а у представителей эволюционной ветви С и их гибридов по материнской линии - 350 п н. Этот маркер был использован нами для поиска популяций A.m.mellifera.
Для анализа мтДНК с каждой пасеки брали по 100 рабочих особей, которых фиксировали в 96% этаноле и хранили в морозильной камере. Тотальную ДНК выделяли из летательных мышц пчел смесью гуанидинтиоционат-фенол-хлороформ по методу P. Chomezynski и N. Sacchi (1987). В качестве генетического маркера использовали межгенный локус COI-COII мтДНК, полиморфизм которого для представителей разных подвидов Apis mellifera был установлен ранее. Полимеразную цепную реакцию (ПЦР) проводили в термоциклере «Циклотерм» при оптимальном температурном режиме. Выделенную ДНК проверяли на качество в 1,5 % агарозном геле. Продукты ПЦР электрофоретически фракционировали в полиакриламидном геле, после чего окрашивали бромистым этидием и фотографировали на трансиллюминаторе.
Результаты и обсуждения
Морфометрические признаки пчёл
Морфометрическому анализу подвергали пчёл с разведенческих пасек края – хоз-во «Покровское» Осинского района, «Парасоль» Пермского района, а также пчёл биостанции ПГПУ «В.-Кважва» Добрянского района. В результате подробного морфометрического анализа были отобраны пчелиные семьи в «племенное ядро» пасек. Средние значения морфометрических признаков по пасекам приведены в таблице 2.
В результате установлено, что исследуемые пчёлы по всем признакам, кроме кубитального индекса соответствуют среднерусским пчёлам.
Кубитальный индекс крыла медоносной пчелы
Средние значения кубитального индекса занесены в сводную таблицу 3, при этом пасеки распределены в две группы – чистопородных (куб. инд.≤ 1,7) и метизированных (куб. инд. > 1,7).
Построенные вариационные кривые значений кубитального индекса дают наглядную информативную картину реального расположения признака (Рис. 1-10).
Дополнительный пик (или «горб») в интервалах не свойственных «чистым» расам – признак отдалённой гибридизации не смотря на то, что среднее значение кубитального индекса соответствует стандарту среднерусской расы ≤ 1,7 (Рис. 1). Иногда это единственный признак гибридизации, поскольку средняя величина кубитального индекса и других мофометрических признаков может соответствовать допустимым для А.m.mellifera значениям.
На отдельных пасеках в распределении значений пчёл в интервале 1,7-2,1 наблюдается избыточное количество пчёл в сравнении с нормальным, что так же свидетельствует о гибридизации с пчёлами южных рас.
Пик, на который приходится максимум встречаемости пчёл группы «метезированных» пасек, в интервале 1,7-1,9 – можно интерпретировать как проявление собственно гибридных пчёл (Рис. 7-10).
Таким образом, построенные вариационные кривые наглядно свидетельствуют о некоторой степени гибридизации пчёл исследованных пасек. Возможно это является особенностью экотипа среднерусских пчел Пермского края.
Молекулярно-генетический анализ пчёл
Кроме морфометрического был проведён молекулярно-генетический анализ пчёл пяти пасек края. Результаты первичного морфометрического анализа и частоты вариантов полиморфного локуса COI — C0 II мтДНК вместе с породными стандартами для среднерусской и серой горной кавказской пчёл приведены в таблице 4.
Пчелы, собранные с пасек края, характеризовались довольно высоким уровнем частоты встречаемости комбинаций PQQ мтДНК. Для среднерусской пчелы A.m.mellifera характерны локусы PQ, PQQ, PQQQ (Cornuet and Garnery, 1991) по материнской линии. По подсчетам частот встречаемости аллелей у всех исследованных пчёл доля аллеля PQQ выше 0,9.
 Значение коэффициента дифференциации Fst между пятью локальными популяциями А.m.mellifera при анализе микросателлитньх локусов 4а110 и ар243 ядерной ДНК изменялось в пределах от 0,028 до 0,123 (Табл. 5). Между большинством локальных популяций значение Fst близко к нулю и свидетельствует об отсутствии значительной генетической дифференциации. Отдельное внимание следует обратить на добрянскую локальную популяцию (В.-Кважва), где коэффициент Fst между ней и другими популяциями колеблется между 0,388 и 0,625 что намного больше, чем между остальными локальными популяциями. Это может свидетельствовать о значительных генетических различиях по отцовской линии.
Таким образом, проведенные исследования показали, что ни один из использованных методов не стоит абсолютизировать. Поскольку аборигенными пчелами для всего Поволжья, в том числе и Пермского края были среднерусские пчелы, то есть пчелы подвида Apis mellifera mellifera L, а завезенные семьи южных подвидов составляли небольшой процент от общего количества разводимых пчел, это привело к тому, что большая часть местных пчел имеет гибридизацию по отцовской линии. Большая вариабельность морфологических признаков, появившаяся в результате гибридизации привела к тому, что часть гибридных пчел может также по экстерьеру соответствовать A.m.mellifera. Поэтому достоверные результаты могут быть получены только при использовании как морфологических, так и молекулярно-генетических методов исследования, охватывающих не только митохондриальный, но и ядерный геномы.
Полученные нами результаты сравнительных пуляционно-генетических исследований прикамских пчел показали, что сочетание относительно высоких долей морфотипа характерного для A.m.mellifera и частот PQ, PQQ, PQQQ может свидетельствовать о том, что исследованные пчёлы имеют происхождение от среднерусских пчел. Некоторые отклонения от стандарта среднерусских пчел могут объясняться как незначительной гибридизацией, так и особенностями экотипа среднерусских пчел Пермского края.
Выводы
1.     Результаты морфометрического анализа показали, что популяция пчёл Пермского края соответствуют стандарту среднерусской расы.
2.     Вариационные кривые значений кубитального индекса показывают как гибридное, так и чистопородное происхождение пчел. Отклонение индекса от общепризнанного стандарта Apis mellifera mellifera возможно является особенностью экотипа среднерусских пчел Пермского края.
3.    Результаты молекулярно-генетического анализа по локусу COI-COII мтДНК и двум микросателлитным локусам ap243 и 4a110 свидетельствуют об отсутствии значительной генетической дифференциации популяции пчёл Пермского края и единстве происхождения популяции по материнской линии от пчел среднерусской расы, аборигенной для Северной Евразии.
Central Russian bee takes a habitat. At present the entire range of the Central Russian bees dominated hybrids of different races of bees. Perm region is the northern boundary of the natural habitat of the species Apis mellifera L. previously established (Petukhov, 1996; Ilyasov et al., 2006) that the aboriginal populations of the honey bee is not uniform - there apiary both purebred and hybrid bee colonies.
The purpose of this study was to study the structure of the continuation of the honey bee population of the Perm region. To do this, define:
1. morphometric signs of working bees on the conventional method (Bilash, Krivtsov, 1991);
2. cubital index wing working bees in the program CooRecorder;
3. polymorphism locus COI-COII mitochondrial DNA, which is a genetic marker race of bees (Nikolenko et al., 2002).
To study the race, as well as to identify and assess the degree of hybridization were investigated ten apiaries from different areas of the Perm Territory (Table. 1).
For the analysis of morphometric characters in each apiary were examined up to 10% of bee colonies. In September 25 individuals were selected from families analyzed were placed in cardboard containers and frozen. To investigate the cubital index and a genetic analysis were taken from each apiary 100 bees and fixed in 96% ethanol.

Materials and methods
Technique of preparation of the body bees
Processing of bees, equipment preparation of the body, the measurement of linear features was carried out in accordance with the recommendations GD Bilash, NI Krivtsov (1991) and the Institute of Beekeeping. The prepared chitin body bees stuck using paper glue stick on paper and laminated. Some measurements were made using ocular micrometer on a binocular microscope MBS-9. The wings were scanned and the program CooRecorder cubital index was measured on race studied bees. The standard values ​​of cubital index Central Russian bees considered 60-65%, or 1.7 according to European standards. For bees southern races characteristic index is less than 60%, or greater than 1.7. Informative picture gives a graphical representation of variation curves, the values ​​of cubital index.
The complex morphometric studies used long proboscis, length and width of the right front wing, his cubital index, length and width of the fourth tergite.
Total studied 1600 individuals with 98 bee bee colonies from 10 apiaries, made preparations in 2800, produced 8,400 measurements using ocular micrometer on a binocular microscope MBS-9.
Methods of genetic analysis
Studies on the genetic analysis was conducted jointly with RA Ilyasov, AV Poskryakovym and AG Nikolenko from the Institute of Biochemistry and Genetics, Ufa Scientific Center, Russian Academy of Sciences. The basis of genetic analysis was installed earlier polymorphism intergenic locus COI-COII representatives of different subspecies of the honeybee Apis mellifera. It was found that the extended AT-rich intergenic site mtDNA. Localized between genes and COI COII and encoding the amino acid sequence can be used as a marker to distinguish between subspecies Apis mellifera mellifera (honeybee of Central race) and Amcaucasica (gray mountain Caucasian bee) due to variability in the length due to different ratios of elements P and Q, where the representatives of intergenic site branches of M (Ammellifera), native to the Perm region, has a combination of PQQ, whereas representatives of branches with (Amcaucasica, Amcamica, Amligustica), Hybridization which is observed in the Perm region, there is a unique element of Q. Thus, intergenic locus COI-COII mtDNA from representatives of evolutionary branches with their hybrids and maternal 268 bp short intergenic locus COI-COII mtDNA from representatives of branches of M and these loci are easily separated by electrophoresis. The size of the PCR product intergenic locus COI-COII mtDNA gene and comprising the representatives tRNKLeu Ammellifera, is about 600 bp, and the representatives of the evolutionary branches with their hybrids and the maternal line - 350 n n. This marker was used to search for our populations Ammellifera.
For the analysis of mtDNA from each apiary took 100 working individuals, which were fixed in 96% ethanol and stored in a freezer. Total DNA was isolated from muscle flying bee mixture guanidintiotsionat-phenol-chloroform method P. Chomezynski and N. Sacchi (1987). As the genetic marker used intergenic locus COI-COII mtDNA polymorphisms for which representatives of different subspecies Apis mellifera has been installed earlier. Polymerase chain reaction (PCR) was performed in a thermal cycler "Tsikloterm" at the optimum temperatures. The isolated DNA was checked on quality in a 1.5% agarose gel. PCR products were fractionated electrophoretically in a polyacrylamide gel, then stained with ethidium bromide and photographed on a transilluminator.
Results and Discussion
Morphometric characters bees
Morphometric analysis were bees from apiaries razvedencheskih region - host of "Pokrovskoye" Osa region, "Parasol" the Perm region, as well as bees biostation PGPU "V.-Kvazhva" Dobriansky area. As a result of detailed morphometric analysis were selected bee colonies in the "tribal core" apiaries. The mean values ​​of morphometric characters of apiaries are shown in Table 2.
As a result, it found that the bees studied by all indications, except for cubital index correspond Srednerussky bees.
Cubital index wing honeybee
The average values ​​of cubital index are included in the summary table 3, with the apiary divided into two groups - purebred (cu. Ind.≤ 1.7) and metizirovannyh (cu. Ind.> 1.7).
Built variation curves cubital index values ​​give a clear picture of the actual location of the informative sign (Fig. 1-10).
Additional peak (or "hump") at intervals not peculiar to the "pure" races - a sign of distant hybridization despite the fact that the average value of the cubital index complies with the race of Central ≤ 1,7 (Fig. 1). Sometimes it's the only sign of hybridization, since the average value of cubital index and other signs can match mofometricheskih valid for A.m.mellifera values.
At some apiaries in the distribution of values ​​in the range of 1.7-2.1 bees observed an excess amount of bees than normal, which also suggests hybridization with bees southern races.
Peak, which accounts for a maximum occurrence of bees group "metezirovannyh" apiaries in the range of 1.7-1.9 - can be interpreted as a manifestation of the actual hybrid bees (Fig. 7-10).
Thus, the built variation curves clearly demonstrate a certain degree of hybridization bees apiaries studied. Perhaps this is a feature of the Central Russian bee ecotype Perm.
Molecular genetic analysis of bees
Additionally morphometric was conducted molecular genetic analysis of five bees apiaries edge. The results of the primary morphometric analysis and frequency variants polymorphic locus COI - C0 II mtDNA with the breed standards for central Russia and gray mountain Caucasian bees are shown in Table 4.
Bees collected from apiaries the region, characterized by a fairly high frequency of combinations PQQ mtDNA. For the Central Russian bees Ammellifera characterized loci PQ, PQQ, PQQQ (Cornuet and Garnery, 1991) through the maternal line. According to estimates of the frequency of alleles in all studied the bees share allele PQQ above 0.9.
 Fst value of the coefficient of differentiation between the five local populations when analyzing A.m.mellifera mikrosatellitnh loci 4a110 ar243 and nuclear DNA varied from 0.028 to 0.123 (Table. 5). In the majority of the local populations Fst value close to zero indicates the absence of significant genetic differentiation. Special attention should be paid to the local population Dobriansky (B.-Kvazhva), where the coefficient Fst between it and other populations varies between 0.388 and 0.625 is much higher than among the rest of the local populations. This may indicate a significant genetic differences on the paternal side.
Thus, studies have shown that none of the methods used is not absolute. Since the native bees for the whole Volga region, including Perm Krai were Central Russian bees, ie bee subspecies Apis mellifera mellifera L, and the family of the southern subspecies imported accounted for a small percentage of the total farmed bees, this has led to the fact that most of the local bees hybridization is paternal. Large variability of morphological characters that appeared as a result of hybridization has led to the fact that part of the hybrid bees can also match the exterior Ammellifera. Therefore, accurate results can be obtained only by using both morphological and molecular genetic research methods, covering not only the mitochondrial, and nuclear genomes.
Our results of comparative population genetic studies Kama bees showed that the combination of the relatively high proportion of morphotype Ammellifera characteristic frequencies and PQ, PQQ, PQQQ may indicate that the bees have studied the origin of the Central Russian bees. Some deviations from the standard of the Central Russian bees can be explained as a minor hybridization and features of the Central Russian bee ecotype Perm.
Findings
1. The results of morphometric analysis showed that the population of bees Perm Territory to meet the standard of Central race.
2. The variation curve cubital index values ​​show how hybrid and purebred origin of bees. The deviation of the index from the generally accepted standard of Apis mellifera mellifera is a possible feature of the Central Russian bee ecotype Perm.
3. The results of the molecular genetic analysis of the locus of mtDNA COI-COII and two microsatellite loci ap243 4a110 and showed no significant genetic differentiation of populations of bees Perm region and the unity of the origin of the population through the maternal line of the Central Russian bee race, native to northern Eurasia.
  104. Ilyasov R.A., Gaifullina L.R., Saltykova E.S., Poskryakov A.V., Nikolenko A.G. Review of the Expression of Antimicrobial Peptide Defensin in Honey Bees Apis Mellifera L. Journal of Apicultural Science. 2012. Vol.56 No.1. P.115-124.  

Review of the Expression of Antimicrobial Peptide Defensin in Honey Bees Apis Mellifera L. Honey bees defensin have a high level of polymorphism and exist as two peptides - defensin 1 and 2. Defensin 1 is synthesized in the salivary glands and is responsible for social immunity. Defensin 2 is synthesized by cells of the fat body and hemolymph is responsible for individual immunity. Defensins are inducible and controlled by the interaction of Toll and Imd signaling pathways and have a broad spectrum of antimicrobial action. The use of chitosan as an immunomodulator has been shown to lead to an increase in the expression levels of defensin and abaecin in the honey bee organism. Stimulation of the transcriptional activity of the defensin genes will allow for the control of a honey bee colony’s immunity level, and reduce the using of antibiotics and other chemicals. Publication Name: Ilyasov R.A., Gaifullina L.R., Saltykova E.S., Poskryakov A.V., Nikolenko A.G. Review of the Expression of Antimicrobial Peptide Defensin in Honey bees Apis mellifera L. Journal of Apicultural Science. 2012. Vol.56 No.1. P.115-124.

  103. Ильясов Р. А., Гайфуллина Л. Р., Салтыкова Е. С., Поскряков А. В., Николенко А. Г. Дефенсины в противоинфекционной защите медоносной пчелы. Журнал эволюционной биохимии и физиологии. 2012., т. 48, № 5. С. 425-432.  

Дефенсины в противоинфекционной защите медоносной пчелы (Antimicrobial protection of defensins in the honeybees)
Специфические условия жизни медоносной пчелы требуют наличия эффективных механизмов противоинфекционной защиты, одним из важнейших компонентов которой являются дефен-сины — семейство антимикробных пептидов. У медоносной пчелы дефенсины присутствуют в виде двух разных пептидов —дефенсина 1 и 2, обладающих сходством между собой лишь на 55.8 %. Дефенсин 1, синтезируемый в слюнных железах, выполняет важную роль в социальном иммунитете, тогда как дефенсин 2, синтезируемый клетками жирового тела и гемолимфы, является важным фактором в системе индивидуального иммунитета медоносной пчелы. Дефенсины индуцибельны, контролируются взаимодействием Toll и Imd сигнальных путей и обладают широким спектром антимикробного действия.
Specific conditions of life of the honeybee require effective mechanisms of anti-infectious protection, one of the most important components of which are dephenyl Sina - a family of antimicrobial peptides. In honeybee defensins are present as two different peptides -defensina 1 and 2 having a similarity between only 55.8%. Defensin 1, synthesized in the salivary glands, plays an important role in social immunity, whereas defensin 2, synthesized by cells of the fat body and hemolymph, is an important factor in the individual immunity of the honey bee. Defensins inducible, controlled interaction Toll and Imd signaling pathways and have a broad spectrum of antimicrobial action.
Publication Name: Ilyasov R.A., Gaifullina L.R., Saltykov E.S., Poskryakov A.V., Nikolenko A.G. Antimicrobial protection of defensins in the honeybees. Journal of Evolutionary Biochemistry and Physiology. 2012, v. 48 (5) . P. 425-432.
  102. Брандорф А.З., Ивойлова М.М., Ильясов Р.А., Поскряков А.В., Николенко А.Г. Популяционно-генетическая дифференциация медоносных пчел Кировской области. Пчеловодство. 2012. № 7. С. 14-16.  

Популяционно-генетическая дифференциация медоносных пчел Кировской области (Population genetic differentiation of honey bees of the Kirov region)
Показаны результаты анализа породной принадлежности семей медоносных пчел на территории Кировской области с использованием популяционно-генетического и фенотипического методов. Установлено, что, несмотря на гибридизацию местных пчел другими породами, выявляются ареалы локальных популяций аборигенной среднерусской породы.
The results of the analysis of breed of the families of honeybees in the Kirov region using population genetic and phenotypic methods. It was found that, despite the hybridization of native bees other breeds, identifies areas of local populations of native Central Russian breed.
Publication Name: Brandorf A.Z., Ivoilova M.M., Ilyasov R.A., Poskryakov A.V. Nikolenko A.G. Population genetic differentiation of honey bees of the Kirov region. Russian journal of beekeeping. 2012. V. 7. P. 14-16.
  101. Непейвода С.Н., Колбина Л.М., Воробьева С.Л., Санникова Н.А., Масленников И.В. Ильясов Р.А., Николенко А.Г. Анализ генетической дифференциации популяций Apis mellifera в Удмуртии. Пчеловодство. 2011. № 10. С. 12-13.  

Анализ генетической дифференциации популяций Apis mellifera в Удмуртии (Analysis of genetic differentiation of populations of Apis mellifera in Udmurtia republic)
В данной работе приведены результаты исследований генетического потенциала пчел в Удмуртской Республике. В ходе сравнительного популяционно-генетического анализа пчелиных семей определено, что популяции пчел Удмуртии генетически неоднородны.
This paper presents the results of studies of the genetic potential of bees in the Udmurt Republic. During the comparative population-genetic analysis of bee colonies is determined that the bee population of Udmurtia genetically heterogeneous.
Publication Name: Nepeivoda S.N. Kolbina L.M., Vorobyova S.L. , Sannikov N.A., Maslennikov I.V., Ilyasov R.A., Nikolenko A.G. Analysis of genetic differentiation of populations of Apis mellifera in Udmurtia republic. Russian journal of beekeeping. 2011. V. 10. P. 12-13.
  100. Колбина Л.М., Непейвода С.Н., Воробьева С.Л., Санникова Н.А., Масленников И.В. Ильясов Р.А., Николенко А.Г. Генетическая дифференциация популяций Apis mellifera L. в Удмуртской Республике. Аграрная наука Евро-северо-востока. 2011. № 6 (25). С. 46-50.

Генетическая дифференциация популяций Apis mellifera L. в Удмуртской Республике (Genetic differentiation of populations of Apis mellifera L. in the Udmurt Republic)
В данной работе приведены результаты исследований генетического потенциала пчел в Удмуртской Республике. В ходе сравнительного популяционно-генетического анализа пчелиных семей определено, что популяции пчел Удмуртии генетически неоднородны.
This paper presents the results of studies of the genetic potential of bees in the Udmurt Republic. During the comparative population-genetic analysis of bee colonies is determined that the bee population of Udmurtia genetically heterogeneous.
Publication Name: Kolbina L.M., Nepeivoda S.N., Vorobyov S.L., Sannikov N.A., Maslennikov I.V., Ilyasov R.A., Nikolenko A.G. Genetic differentiation of populations of Apis mellifera L. in the Udmurt Republic. Agricultural science Euro-north-east. 2011. V. 6 (25). P. 46-50.
  099. Ilyasov R.A., Kutuev I.A., Petukhov A.V., Poskryakov A.V., Nikolenko A.G. Phylogenetic relationships of dark european honeybees Apis mellifera mellifera L. from the Russian Ural and West European populations. Journal of Apicultural Science. 2011. V. 55. No. 1. P. 67-76.  

Phylogenetics relationships of dark european honeybees Apis mellifera mellifera L. from the Russian ural and west european populations A mitochondrial DNA region covering 5'-end of the gene of the second subunit NADH dehydrogenase (ND2), was PCR amplifi ed in Dark European Honeybees Apis mellifera mellifera from the Urals (Russia) region and in the presumed Apis mellifera macedonica from the Ukraine. Phylogenetic analysis of sequenced DNA samples with GenBank (http://www.ncbi.nlm.nih.gov) data showed the existence of four evolutionary branches where the Ural honeybees were grouped with European A. m. mellifera, and Ukrainian honeybees with European A. m. macedonica. These results suggest the genetic relationship of the Russian Urals and the European populations of A. m. mellifera. These data have allowed us to put forward the hypothesis that the subspecies A. m. mellifera, is a unique specimen of evolutionary branch M. Publication Name: Ilyasov R.A., Kutuev IA, Petukhov A.V., Poskryakov A.V., Nikolenko A.G. Phylogenetics relationships of dark european honeybees Apis mellifera mellifera L. from the Russian Ural and west european populations. Journal of Apicultural Science. 2011. V. 55 (1). P. 67-76.

  098. Хажеева Р.Р., Ильясов Р.А. Популяции темной лесной пчелы Apis mellifera mellifera L. Урала и Поволжья. Mатериалы докладов Международной научно-практической конференции "Современные проблемы биологии и экологии". Махачкала. 2011. C. 212-213.  

Медоносная пчела Apis mellifera L. в различных природно-климатических условиях изменялась соответственно условиям обитания. В результате длительного естественного отбора пчелы стали отличаться по ряду признаков. В разных биоценозах сформировались местные, географические расы пчел. На основе морфологических признаков выделяют 28 подвидов (Engel, 1999), медоносные пчелы вида Apis mellifera L. Наиболее широкое распространение в практической деятельности человека получили пчелы итальянской, среднерусской, серая горная кавказской, краинской, карпатской рас. Развитие сельского хозяйства и транспорта привел к распространению во всем мире медоносных пчел, что стало началом гибридизации подвидов. В России огромный естественный ареал охватывает подвид Apis mellifera mellifera L. (темная лесная пчела).
На территории республики Башкортостан многие тысячелетия существует подвид A.m.mellifera, обладающий хорошей адаптацией к резко континентальному климату горного Урала и способностью к активному, кратковременному медосбору в условиях короткого лета (Кожевников, 1929). Но массовый завоз южных пчел привел к массовой гибридизации и нарушению генетической системы популяции A.m.mellifera в республики Башкортостан (Газизов, 1987; Билаш и др., 1996; Гранкин, 1997).
Темная лесная пчела имеет ряд сохранившихся локальных популяций на Среднем Урале и в Поволжье. Исследования на основе морфометрических признаков и анализа полиморфизма межгенного локуса COI-COII митохондриальной ДНК показал состояние генофонда популяции A.m.mellifera (Николенко, Поскряков, 2002, Ильясов и др., 2006).
А.В. Петухов с соав. (1996) на основе исследования экстерьерных признаков пчел в Пермской области показали, что местные пчелы неоднородны по своему составу. На пасеках Уинского, Красновишерского, Нытвенского, Частинского, Кункурского районов параметры соответствовали параметрам среднерусской расы. На пасеках Чернушинского, Очерского, Куединского районов признаки свидетельствовали о гибридизации пчел. Гибридизированные пчелы в изученной части популяции составляли в среднем 25 %. На этих территориях для обогащения генофонда проводился обмен матками и пакетами пчел между областями с целью создания единого массива пчел прикамской популяции. Авторами были четко выделены генотипически сходные группы в двух районах: Красновишерском и Уинском.
Исследования А. В. Петухова с соавт., на основе морфометрических признаков и Р.А. Ильясова с соавт. (2006), на основе полиморфизма межгенного локуса COI-COII мт ДНК позволяли говорить о существовании на Среднем Урале и в Поволжье локальных популяций A.m.mellifera. Таким образом, были обнаружены локальные популяции A.m.mellifera: красновишерская, южно-прикамская, татышлинская и бурзянская. А принадлежность уинской популяции к A.m.mellifera не подтвердились.
Л.М. Колбиной, С.Н. Непейвода (2005) были изучены пасеки шести районов Удмуртской республики: Завьяловского, Якшур-Бодьинского, Камбарского, Вавожского, Шарканского и Воткинского. От каждой семьи отбиралось по 30 пчел. Всего было исследовано 188 семей. По результатам исследований только у 23 семей средние значения морфометрических признаков входили в рамки среднерусской породы, еще 23 семьи были отнесены к южным породам, остальные 142 семьи являются гибридными даже по средним значениям. По результатам исследований выявлено большое подвидовое разнообразие и высокий уровень гибридизации.
Р.А. Ильясов с соавт. (2007) отметили, что на территории Бурзянского, Бирского, Татышлинского районов существуют локальные популяции Apis mellifera mellifera. Пчёлы, собранные на пасеках этих районов Республики Башкортостан, характеризовались довольно высоким уровнем частоты встречаемости комбинаций PQQ мт ДНК. Для среднерусской пчелы A.m.mellifera характерны локусы PQ, PQQ, PQQQ (Cornuet, Garnery, 1991) по материнской линии. В Кушнаренковской, Благовещенской, Иглинской районах выборки популяции темной лесной пчелы находились в некоторой степени гибридизации. Р.А. Ильясов с соавт. (2010) собрали и проанализировали медоносные пчелы A.m.mellifera из заповедника Шульган-Таш Бурзянского района республики Башкортостан, из Башкирской опытной станции пчеловодства Иглинского района республики Башкортостан и из Юсьвенского района Коми-Пермяцкого округа Пермского края. Проведенный анализ трех удаленных друг от друга популяций показал, что сохранились локальные популяции медоносной пчелы подвида A. m. mellifera, которые способны к длительному существованию во времени (Ильясов с соавт., 2010).
213
Л. М. Колбина (2009) провела сравнение популяции пчел Западного Предуралья с гибридной популяцией Иглинского района республики Башкортостан на основе анализа ядерной и мт ДНК. Результат анализа показал обособленность Завьяловской популяции пчёл от Комбарской, Мало-Пургинской, Глазовской, Можгинской, Шарканской и Иглинской разделенные на две достоверно отличающиеся друг от друга группы, внутри которых не наблюдаются статистически значимой генетической дифференциации. На территории Западного Предуралья наблюдается генетически подразделенная популяция пчёл среднерусской расы, частично гибридизированная с подвидами из южных регионов.
А.Н. Талипов (2007) проводил исследования пчел районов Башкирского Зауралья: Учалинского,
Абзелиловского, Баймакского, Зианчуринского, Зилаирского, Белорецкого, Хайбуллинского и полученные данные сопоставил с пчелами из пасек Бурзянского района горно-лесной зоны Башкортостана. Изучение пчелы из пасек Бурзянского района горно-лесной зоны Башкортостана показало, что там находится основное генетическое ядро диких бортевых пчел. Морфологическая и генетическая дифференциация пчел Башкирского Зауралья по сравнению с бурзянской бортевой указывали на процессы гибридизации, представляющие угрозу чистоте ее генофонда.
Таким образом, на Урале и в Поволжье генетическая структура популяций A.m.mellifera изучена недостаточно. В связи с этим в дальнейшем планируем детальное изучение генетической структуры популяции темной лесной пчелы на Урале.
A honey bee Apis mellifera L. in different climatic conditions varied environmental conditions, respectively. As a result of a long natural selection bees began to differ on a number of grounds. In different biological communities formed local geographical races of bees. On the basis of morphological characters distinguish 28 subspecies (Engel, 1999), honeybees Apis mellifera L. species most widely used in practice people received the Italian bee, central Russia, gray mountain Caucasian Krajina, Carpathian races. The development of agriculture and transport has led to the worldwide dissemination of honeybees that was the beginning of hybridizing subspecies. Russia has huge natural range covers subspecies of Apis mellifera mellifera L. (dark forest bee).
On the territory of the Republic of Bashkortostan for many millennia there subspecies Ammellifera, has a good adaptation to the extreme continental climate of the Urals Mining and the ability to take an active, short-term honey flow in the short summer (Kozhevnikov, 1929). But the massive importation of bees led to the Southern hybridization and mass violation of the genetic system Ammellifera population in the Republic of Bashkortostan (Gazizov 1987; Bilash et al., 1996; Grankin, 1997).
The dark forest bee has a number of surviving local populations in the Middle Urals and the Volga region. Studies based on morphometric traits and polymorphism analysis of intergenic locus COI-COII mitochondrial DNA showed the state of the gene pool of the population Ammellifera (Nikolenko, Poskryakov, 2002, Ilyasov et al., 2006).
AV Petukhov with Soave. (1996) based on a study of exterior signs of bees in the Perm region showed that native bees are heterogeneous in composition. On apiaries Uinskogo, Krasnovishersky, Nytvensky, Chastinskogo, Kunkurskogo areas settings match the settings of Central race. On apiaries Chernushinsky, Ocher, Kuedinsky areas showed signs of hybridization bees. Hybridized bees in a part of the population studied averaged 25%. In these areas, to enrich the gene pool held an exchange queens and packages of bees between regions with the aim of creating a single array bee populations in Kama region. The authors clearly marked genotypically similar groups in two areas: Krasnovishersky and Uinskom.
Research AV Petukhov et al., Based on the morphometric characters and RA Ilyasov et al. (2006), based on the polymorphism of the intergenic locus COI-COII mt DNA suggests the existence of the Middle Urals and the Volga region of local populations Ammellifera. Thus, local populations were found Ammellifera: Krasnovishersk, South Prikamskaya, tatyshlinskaya and Burzyan. A membership to the population uinskoy Ammellifera not confirmed.
LM Kolbina, SN Nepeivoda (2005) were studied apiary six districts of the Udmurt Republic: Zavyalovsky, Yakshur-Bodyinsky, Kambarka, Vavozh, Sharkansky and Votkinsk. From each family were selected to 30 bees. There were studied 188 families. According to the research only 23 families mean values ​​of morphometric characters are within the scope of Central Russian breed, another 23 families were assigned to the southern species, the remaining 142 families are hybrid even mean values. According to the research identified a large variety of subspecies and a high level of hybridization.
RA Ilyasov et al. (2007) noted that in the territory Burzyansky, Birsk, Tatyshlinskogo areas there are local populations of Apis mellifera mellifera. Bees collected on apiaries those areas of the Republic of Bashkortostan, were characterized by a fairly high frequency of combinations PQQ mt DNA. For the Central Russian bees Ammellifera characterized loci PQ, PQQ, PQQQ (Cornuet, Garnery, 1991) through the maternal line. In Kushnarenkovsky, Annunciation, iglinsky district sampling dark forest bee populations are in some degree of hybridization. RA Ilyasov et al. (2010) collected and analyzed honeybees Ammellifera of reserve Shulgan-Tash Burzyansky district of the republic of Bashkortostan, Bashkir Research Station of beekeeping iglinsky district of the Republic of Bashkortostan and Yusvenskogo region of Komi-Perm district of the Perm region. The analysis of three widely separated populations showed that preserved local populations of the honey bee subspecies A. m. mellifera, which are capable of continued existence in time (Ilyasov et al., 2010).
213
LM Kolbina (2009) compared the bee population of the Western Urals hybrid population iglinsky district of Bashkortostan Republic on the basis of the analysis of the nuclear DNA and mtDNA. The results showed the isolation of populations of bees from Zavyalovsky Kombarskoy, Little Purginskoy, Glazov, Mozhginsky, Sharkan and Iglinsky divided into two significantly different from each other group, within which no statistically significant genetic differentiation. On the territory of the Western Urals observed genetically subdivided population of bees of Central race, partially hybridized with the subspecies of the southern regions.
AN Talipov (2007) conducted research on bees of the Bashkir Trans-Urals regions: Uchalinsky,
Abzelilovsky, Baimak, Zianchurinskogo, Zilair, Beloretsk, Haybullinskogo and findings contrasted with bees from apiaries Burzyansky area mountain-forest zone of Bashkortostan. The study bees from apiaries Burzyansky area mountain-forest zone of Bashkortostan showed that there is a fundamental genetic tree hollow core of wild bees. Morphological and genetic differentiation of bees of the Bashkir Trans-Urals compared with wild-hive Burzyan indicates the process of hybridization that threaten the purity of its gene pool.
Thus, in the Urals and the Volga region Ammellifera genetic structure of populations is not well understood. In this regard, we plan to further detailed study of the genetic structure of populations of the dark forest bees in the Urals.
  097. Kolbina L., Nepevoda S., Nikolenko A., Ilyasov R., Vorobyeva S., Maslennikov I. The race analysis of bee-colonies from Sharkanskiy and Zavyalovskiy districts of the Udmurt Republic. XLVIII Naukowa konferencja pszczelarska. Materials of international conference. 2011. Pszczyna. 2011. P. 31-32.  

In our research the samples from 15 bee-colonies from Koryakino, 19 from Sharkan, 19 from Lyuk, 15 - Postol, and 5 from Makarovo were used. In this research we used morphometric and genetic (the polymorphism of intergenic locus COI-COII) methods (table 1).
The bee-colonies from Postol population descend from bees queens of southern races without admixture of aboriginal race (as show morphological studies, P<0.001) and the bee-colonies from Lyuk and Makarovi descend from populations of bees queen of the Apis mellifera mellifera and have no genes of southern races. But analysis of the exterior of the bee-colonies of these two populations suggests that a serious hybridization of colonies takes place on the drone line, since there are serious differences with the standard of the Apis mellifera mellifera (cubital index is less than 57% and almost 20% of bee- colonies have width of third tergite less than 4.8 mm). The Sharkan and Koryakino populations have no clear parentage of the maternal line, and in Sharkan population the few colonies have an abnormal structure of the intergenic locus COl-COII of mitochondrial DNA - PQ. All of these confirms the version of heterogeneous parentage of these bee- colonies. However, morphological characteristics of both these populations, especially Koryakino population, are close to the Apis mellifera mellifera and do not satisfy the standard only by cubital index (<60%) (that occurs not in all bee-colonies). As a result, none of the studied populations can be an attribute to the Apis mellifera mellifera race of bees.
  096. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Популяционная генетика медоносной пчелы центральной части республики Башкортостан и анализ таксономии подвидов. Материалы Всероссийской научно-практической конференции "Мир пчел". Ижевск. 2011. С. 51–57.

Нами был изучен полиморфизм микросателлитных локусов 4a110, A8, a43 ядерной ДНК и локуса COI-COII мтДНК в популяции пчел центральной части республики Башкортостан (Табл. 2).
По результатам анализа частот аллелей микросателлитных локусов были получены генетические расстояния Nei (1978) (Табл. 3), на основе которых кластерным анализом методом ближайшего соседа была построена дендрограмма генетических отношений населений пчел изучаемых нами популяций. На дендрограмме наблюдалось подразделение на 2 крупные ветви. Пчелы центральной части республики Башкортостан группируются совместно с ранее определенной гибридной популяцией Иглинского района, что свидетельствует о гибридизации данной популяции.
По результатам анализа наблюдаемых частот аллелей микросателлитных локусов 4a110, A8, a43 ядерной ДНК были рассчитаны коэффициенты инбридинга Fis и Fit, коэффициент дифференциации Fst и гетерозиготность Ho, Hs и Ht, для изучаемых нами локальных популяций.
В популяции центральной части республики Башкортостан наблюдается аутбридинг Fis=-0,287 и Fit=-0,199. Кроме того в популяции наблюдается низкий уровень генетической подразделенности Fst=0,068 и избыток гетерозиготности Ho=0,634 < Hs=0,486 и Ht=0,504.На основе сравнительного анализа нуклеотидной последовательности фрагмента гена ND2 мтДНК подвидов A.m.сarnica, A.m.carpatica, A.m.caucasica, A.m.ligustica было обнаружено 11 сайтов замен нуклеотидов (Табл. 5).
На основе кластерного анализа методом ближайшего соседа фрагментов гена ND2 мтДНК подвидов пчел была построена дендрограмма, на которой карпатские пчелы, ранее не определенные однозначно группировались в отдельный кластер, отличный от подвидов A.m.сarnica, A.m.caucasica и A.m.ligustica (Рис. 2).
Таким образом, на основе анализа полиморфизма микросателлитных локусов 4a110, a8, a43 ядерной ДНК и межгенного локуса COI-COII мтДНК в популяции медоносной пчелы Кушнаренковского района было показано значительное влияние трутневого фона гибридного происхождения. Также была определена генетическая структура популяции медоносной пчелы Кушнаренковского района на основе анализа полиморфизма микросателлитных локусов 4a110, a8, a43 ядерной ДНК, которая характеризуется аутбридингом, низким уровнем генетической подразделенности и избытком гетерозиготности. На основе сравнительного анализа нуклеотидной последовательности фрагмента гена ND2 мтДНК показана генетическая обособленность популяции пчел Закарпатской области Украины.
We have studied the polymorphism of microsatellite loci 4a110, A8, a43 nuclear DNA loci and mtDNA COI-COII in the bee population of the central part of the republic of Bashkortostan (Tab. 2).
According to the analysis of allele frequencies of microsatellite loci were obtained genetic distances Nei (1978) (Table. 3) on which the cluster analysis method of the nearest neighbor was constructed dendrogram of genetic relationship bee populations we studied populations. In the dendrogram observed unit 2 large branches. Bees are a central part of the Republic of Bashkortostan are grouped together with the previously defined hybrid populations iglinsky district, indicating that the hybridization of a given population.
According to the analysis of the observed allele frequencies of microsatellite loci 4a110, A8, a43 nuclear DNA were calculated inbreeding coefficients Fis and Fit, Fst differentiation factor and heterozygosity Ho, Hs and Ht, we study local populations.
The population of the central part of the Republic of Bashkortostan is observed outbreeding Fis = -0,287 and Fit = -0,199. Also in the population have low levels of genetic subdivision Fst = 0,068 and the excess of heterozygosity Ho = 0,634 <Hs = 0,486 and Ht = 0,504.Na basis of a comparative analysis of the nucleotide sequence of a gene fragment ND2 mtDNA subspecies Amsarnica, Amcarpatica, Amcaucasica, Amligustica was There are 11 sites nucleotide substitutions (Table. 5).
On the basis of cluster analysis by the nearest neighbor ND2 gene fragments of mtDNA subspecies of bees dendrogram was built on which the Carpathian bees, previously defined clearly grouped in a separate cluster distinct from the subspecies Amsarnica, Amcaucasica and Amligustica (Fig. 2).
Thus, based on the analysis of polymorphism of microsatellite loci 4a110, a8, a43 nuclear DNA and the intergenic locus COI-COII mtDNA in honeybee populations Kushnarenkovsky area has been shown to significantly influence the background drone of hybrid origin. It was also determined the genetic structure of honey bee populations Kushnarenkovsky region based on the analysis of polymorphism of microsatellite loci 4a110, a8, a43 nuclear DNA, which is characterized by outbreeding, low levels of genetic subdivision and excess heterozygosity. On the basis of a comparative analysis of the nucleotide sequence of a gene fragment ND2 shown mtDNA genetic isolation of populations of bees of the Transcarpathian region of Ukraine.  
  095. Пискарева Е. М., Ильясов Р. А., Поскряков А. В., Николенко А. Г. Проблемы сохранения среднерусской расы пчел в республике Башкортостан. Материалы Всероссийской научно-практической конференции "Актуальные проблемы изучения биоты Южного Урала и сопредельных территорий". Орск. 2010. С. 55-57.  

Перемещение медоносных пчел (Apis mellifera L.) из одних биоклиматических зон в другие и вызванная этим гибридизация привели к тому, что на месте естественно сложившихся местных популяций сформировались помеси неизвестного происхождения. Изучение их генетических характеристик позволит выявить резервные очаги местообитания Apis mellifera mellifera пчелы среднерусской (Ильясов с соавт., 2008).
В связи с возрастанием уровня гибридизации популяций A.m.mellifera в России возможность полного исчезновения генофонда этого подвида становится все большей реальностью. Факт того, что в условиях глобальной гибридизации пчел еще сохранились не подверженные гибридизации популяции A.m.mellifera, послужил некоторым толчком к деятельности по сохранению и восстановлению генофонда популяций A.m.mellifera в России как наиболее целесообразного подвида для разведения в климатических условиях России (Ильясов с соавт., 2010).
Морфометрические исследования были малопригодны для идентификации A.m.mellifera в условиях гибридизации, и только с введением молекулярногенетических методов удалось доказать, что отдельные популяции A.m.mellifera все же сохранились. Изучение и сохранение биоразнообразия являются одной из ключевых задач современной экологии. Успешная охрана биоразнообразия, как условие сохранения устойчивости экосистем и биосферы в целом, возможно только на основе всестороннего изучения составляющих ее видов и популяций (Прокофьева, 2004). Для изучения мы взяли 3 популяции пчел из Альшеевского района республики Башкортостан. Результаты анализировались сравнительно с результатами по анализу популяций пчел Красновишерского р-на Пермского края, ранее определенные как A.m.mellifera, и популяций пчел Красноуфимского р-на Свердловской обл., ранее определенные как гибридные популяции (Ильясов с соавт., 2006).
Нами был изучен полиморфизм микросателлитных локусов ap243, 4a 110, a24, a8, a43, a113, ap049 ядерной ДНК и полиморфизм локуса COI-COII мтДНК. По результатам анализа частот аллелей локусов были получены генетические расстояния, на основе которых кластерным анализом методом ближайшего соседа была построена дендрограмма генетических отношений населений пчел изучаемых нами популяций. Дендрограммы были построены отдельно по микросателлитным локусам и отдельно с использованием локусов ядерной и митохондриальной ДНК.
По результатам анализа межгенного локуса COI-COII мтДНК пасеки северной части района оказалась полностью гибридной (частота маркера для
A.m.mellifera PQQ=0%), пасеки центральной части района - гибридная наполовину (частота PQQ=60%), пасеки южной части района - семьи пчел имеют происхождение от Apis mellifera mellifera по материнской линии (частота PQQ=100%).
По результатам анализа микросателлитных локусов яДНК (4А110, ар243, ар049, А24, А8, А43, А113) и межгенного локуса COI-COII мтДНК пасеки северной части района группируются с пасеками Свердловской области, что говорит о их гибридном происхождении, пасеки южной части района группируется с пасекой Пермского края, что говорит о происхождении от Apis mellifera mellifera , а пасеки центральной части района находятся между первой и второй группой, что говорит о их большой степени гибридизации.
Такое расположение можно объяснить тем, что в популяции пчел Альшеевского района республики Башкортостан гибридизация шла в большей степени по отцовской линии, чем по материнской.
Move the honey bee (Apis mellifera L.) from one bioclimatic zones in the other and the resulting hybridization has led to that in place of the existing local populations naturally formed hybrids of unknown origin. The study of their genetic characteristics will reveal reserve pockets of habitat Apis mellifera mellifera bees of Central (Ilyasov et al., 2008).
In connection with the increase in the level of hybridization Ammellifera populations in Russia to the complete disappearance of the gene pool of this subspecies is becoming more real. The fact that in the global hybridization of bees still remain not subject to hybridization population Ammellifera, served as the impetus for some of the conservation and restoration of the gene pool of populations Ammellifera in Russia as the most appropriate sub-species breeding in the climate conditions of Russia (Ilyasov et al., 2010 ).
The morphometric studies were of little use for identification Ammellifera in hybridization conditions, and only with the introduction of molekulyarnogeneticheskih methods failed to prove that the individual populations Ammellifera still preserved. The study and conservation of biodiversity is one of the key problems of modern ecology. Successful protection of biodiversity, as a condition of preservation of stability of ecosystems and the biosphere as a whole, can only be based on a comprehensive study of its constituent species and populations (Prokofiev, 2004). For the study, we took 3 of the bee population Alsheevsky district of Bashkortostan. The results were analyzed in comparison with the results of analysis of bee populations Krasnovishersky district of the Perm region, previously defined as Ammellifera, and bee populations Krasnoufimsky district of Sverdlovsk region., Previously defined as hybrid populations (Ilyasov et al., 2006).
We have studied the polymorphism of microsatellite loci ap243, 4a 110, a24, a8, a43, a113, ap049 nuclear DNA polymorphism locus COI-COII mtDNA. According to the analysis of allele frequencies loci were obtained genetic distances, based on which the cluster analysis method the nearest neighbor was constructed dendrogram of genetic relationship bee populations we studied populations. Dendrogram were constructed separately for microsatellite loci and loci separately using nuclear and mitochondrial DNA.
According to the analysis of intergenic locus COI-COII mtDNA apiary northern part of the district was completely hybrid (frequency marker for
Ammellifera PQQ = 0%), the central part of the apiary - a hybrid half (frequency PQQ = 60%), the southern part of apiaries - bee colonies are derived from Apis mellifera mellifera maternal (frequency PQQ = 100%).
According to the analysis of nuclear DNA microsatellite loci (4A110, ar243, ar049, A24, A8, A43, A113) and intergenic locus COI-COII mtDNA apiary northern part of the apiaries are grouped with the Sverdlovsk region, indicating that their hybrid origin, the apiary southern region grouped apiary with the Perm region, indicating that the origin of Apis mellifera mellifera, and the central part of the apiary located between the first and second group, indicating their high degree of hybridization.
This arrangement may be explained by the fact that the population of bees Alsheevsky district of Bashkortostan hybridization was largely paternal than maternal.
  094. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Partial sequencing analysis of gene ND2 honeybee Apis mellifera caucasica from Krasnaya polyana of Krasnodarskii region of Russia. GenBank. 2010. accession numbers HQ318729-HQ318730 (http://www.ncbi.nlm.nih.gov).  

Apis mellifera caucasica bio-material 3692 NADH dehydrogenase subunit 2 (ND2) gene, partial cds; mitochondrial
GenBank: HQ318730.1
LOCUS HQ318730 540 bp DNA linear INV 22-FEB-2011
DEFINITION Apis mellifera caucasica bio-material 3692 NADH dehydrogenase
subunit 2 (ND2) gene, partial cds; mitochondrial.
ACCESSION HQ318730
VERSION HQ318730.1 GI:323522307
KEYWORDS .
SOURCE mitochondrion Apis mellifera caucasica (Caucasian honeybee)
ORGANISM Apis mellifera caucasica
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;
Neoptera; Endopterygota; Hymenoptera; Apocrita; Aculeata; Apoidea;
Apidae; Apis.
REFERENCE 1 (bases 1 to 540)
AUTHORS Ilyasov,R.A., Nikolenko,A.G. and Poskryakov,A.V.
TITLE Partial sequencing analysis of gene ND2 honeybee Apis mellifera
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 540)
AUTHORS Ilyasov,R.A., Nikolenko,A.G. and Poskryakov,A.V.
TITLE Direct Submission
JOURNAL Submitted (23-SEP-2010) Ufa Scientific Center of Russia Academy of
Sciences, Institute of Biochemistry and Genetics, Prospect
Octyabrya, Ufa, Bashkortostan 450054, Russia
FEATURES Location/Qualifiers
source 1..540
/organism="Apis mellifera caucasica"
/organelle="mitochondrion"
/mol_type="genomic DNA"
/isolation_source="Krasnaya Polyana apiary colony 2"
/sub_species="caucasica"
/bio_material="3692"
/db_xref="taxon:200407"
/country="Russia: Krasnodarskii region"
gene 25..>540
/gene="ND2"
CDS 25..>540
/gene="ND2"
/codon_start=1
/transl_table=5
/product="NADH dehydrogenase subunit 2"
/protein_id="ADX94781.1"
/db_xref="GI:323522308"
/translation="MFFMNFKYHWFIYLLITIFVLMMNSNNIFIQWMLMEFGTIISIS
LINIKSTNKTPSLIYYSVSVISSIFLFFMIIVYLSSISFIKTDTFNFMVQMMFFLKIG
TFPFHFWMIYSYEMMNWKQIFLMSTLIKFIPIYMMVSMTKINSWTLYFLITNSLYISF
YANKFYTLKKLL"
ORIGIN
1 aattttatat atatactatt acttatcttc ttcataaatt ttaaatacca ctgatttatt
61 tatcttttaa ttactatttt tgtattaata ataaattcca ataatatttt tattcaatga
121 atattaatag aatttggtac aatcattaga attagattaa ttaatattaa atccacaaat
181 aaaaccccaa gattaattta ttattcagta tcagtaattt caagaatttt tttattcttt
241 ataattattg tatacttatc atccattaga tttattaaaa cagatacttt taattttata
301 gttcaaataa tatttttttt aaaaattgga actttcccct ttcatttttg aataatttat
361 tcttatgaaa taataaattg aaagcaaatt tttttaatat caacattaat taaatttatt
421 ccaatttata taatagtttc aataactaaa attaattcat gaacattata ttttttaatt
481 acaaatagat tatatatttc attttatgct aataaatttt acactctaaa aaaattacta
//
  093. Ильясов Р.А., Петухов А.В., Поскряков А.В., Николенко А.Г. Оценка популяционно-генетической структуры населения медоносной пчелы Среднего и Южного Урала. Международная конференция "Пчеловодство – XXI век". Москва. 2010. С. 55-59.  

Для изучения генетической структуры населения медоносной пчелы Среднего и Южного Урала мы анализировали полиморфизм локуса COI-COII митохондриальной ДНК и микросателлитных локусов ap243, 4a110, a24 и a8. В трех локальных популяциях медоносной пчелы (бурзянская, иглинская и юсьвенская) наблюдались следующие частоты аллей (табл.1).
Межгенный локуса COI-COII мтДНК у медоносной пчелы представлен 4 состояниями, где единственный элемент Q на Урале характеризует происхождение по материнской линии от подвидов пчел из южных регионов - A.m.caucasica, A.m.carnica, A.m.ligustica и других. Все остальные комбинации элементов P и Q на Урале характеризуют медоносную пчелу подвида A.m.mellifera по материнской линии. Как показывает таблица 2, бурзянская и юсьвенская популяции характеризуются максимальным содержанием пчел, происходящих от A.m.mellifera по материнской линии.
Уровень гетерозиготности является одним из основных показателей в популяционногенетическом анализе пчел, характеризующий величину биологического и генного разнообразия. Для популяции медоносной пчелы известно, что избыточная и недостаточная гетерозиготность ведет к неблагоприятным явлениям. Для популяции медоносной пчелы в норме, по результатам наших многолетних исследований в России, свойственен небольшой дефицит гетерозигот (Ильясов с соавт., 2008).
Мы рассчитали величину средней наблюдаемой гетерозиготности внутри субпопуляции HO (табл. 1) и сравнили ее со средней ожидаемой гетерозиготностью внутри субпопуляции. Во всей популяции по всем микросателлитным локусам ядерной ДНК наблюдается дефицит гетерозигот. Гетерозиготность внутри субпопуляций Н больше гетерозиготности между субпопуляциями DST. Величина межпопуляционной генетической дифференциации GST для всей популяции небольшая и приближается к 0,1.
Показатели гетерозиготности (табл. 3) для каждой локальной популяции также
различались. Наибольший дефицит гетерозигот наблюдался в иглинской локальной популяции, а наименьший - в бурзянской. Межпопуляционная составляющая гетерозиготности DST наименьшая в бурзянской локальной популяции, а наибольшая - в иглинской. Соответственно, наименьшая величина межпопуляционной генетической дифференциации GST наблюдается в бурзянской локальной популяции, а наибольшая - в иглинской.
На основе изучения полиморфизма 4 микросателлитных локусов были рассчитаны коэффициенты инбридинга F-статистики для всей популяции (табл. 4). Расчет индекса фиксации (Wright, 1965) FiS, отражающего инбридинг особи относительно субпопуляции показал, что во всей популяции наблюдается дефицит гетерозигот. Индекс фиксации FiT, отражающий инбридинг особи относительно всей общей популяции, также показал дефицит гетерозигот во всей популяции, но на более высоком уровне. Индекс фиксации FST, отражающий инбридинг между субпопуляциями относительно всей целой популяции, а также уровень дифференцированности популяции показал, что популяция в целом подразделена на субпопуляции.
Индексы фиксации, рассчитанные для субпопуляций были следующие (табл. 5). По значениям FST наименее подразделенной оказалась бурзянская популяция, а наиболее подразделенной иглинская. Наибольший уровень инбридинга и дефицит гетерозигот на уровне субпопуляций FiS и на уровне всей популяции FiT наблюдался в бурзянской популяции, а наименьший - в юсьвенской популяции. В иглинской популяции наблюдался аутбридинг с избытком гетерозигот.
На основе стандартных генетических расстояний (Nei, 1978) по данным анализа полиморфизма локуса COI-COII митохондриальной ДНК и микросателлитных локусов ap243, 4a110, a24 и a8 была построена дендрограмма (рис. 1) с использованием кластерного анализа методом ближайшего соседа, используя в качестве меры связи метод Варда, а меры расстояния - Евклидову дистанцию. На дендрограмме наблюдается распределение локальных популяций на два кластера, где максимально гибридизованная иглинская популяция группируется отдельно от двух других. Сходная картина распределения локальных популяций наблюдается и в случае анализа только микросателлитных локусов ядерной ДНК.
Проведенный нами анализ генетической структуры трех удаленных друг от друга локальных популяций медоносной пчелы Южного и Среднего Урала показал их генетическую дифференциацию и подразделенность на субпопуляции в целом. Отмечалась совместная группировка юсьвенской популяции медоносной пчелы с бурзянской, которая ранее была определена на основе генетических исследований как популяция среднерусской пчелы Apis mellifera mellifera. Это свидетельствует о происхождении юсьвенской локальной популяции медоносной пчелы по ядерной и митохондриальной ДНК от подвида A.m.mellifera. Ранее определенная на основе генетических исследований гибридная иглинская локальная популяция медоносной пчелы в данном исследовании располагалась отдельно. Следует отметить характерный для большинства популяций медоносной пчелы на Урале небольшой дефицит гетерозигот и инбридинг. Гибридная иглинская популяция, наоборот, характеризуется избытком гетерозигот и аутбридингом. Таким образом, на Южном (Бурзянский район республики Башкортостан) и Среднем Урале (Юсьвенский район Коми-Пермяцкого округа Пермского края) еще сохранились локальные популяции медоносной пчелы подвида A.m.mellifera с достаточными для длительного существования популяции во времени величиной ареала и численности.
To study the genetic structure of the honey bee population of the Middle and South Urals, we analyzed the polymorphism locus COI-COII mitochondrial DNA and microsatellite loci ap243, 4a110, a24 and a8. The three local populations of the honey bee (Burzyan, Iglinskiy and yusvenskaya) observed the following frequencies alleys (Table 1).
Intergenic locus COI-COII mtDNA in honeybee represented 4 states, where Q is the only element in the Urals describes the origin of the maternal line of the sub-species of bees from southern regions - Amcaucasica, Amcarnica, Amligustica and others. All other combinations of elements P and Q in the Urals characterize the honeybee subspecies Ammellifera through the maternal line. As shown in Table 2, and Burzyan yusvenskaya populations are characterized by the highest content of bees originating from Ammellifera through the maternal line.
The level of heterozygosity is one of the main indicators in the analysis populyatsionnogeneticheskom bees characterizing the magnitude of the biological and genetic diversity. For the honeybee population is known that excessive and insufficient heterozygosity lead to adverse events. For the honeybee population is normal, according to the results of our many years of research in Russia peculiar small deficit of heterozygotes (Ilyasov et al., 2008).
We have calculated the value of the average observed heterozygosity in a subpopulation of HO (Table. 1) and compared it with the average expected heterozygosity in a subpopulation. In the entire population of all the nuclear DNA microsatellite loci deficient heterozygotes. Heterozygosity in subpopulations N greater heterozygosity between subpopulations DST. The value of inter-population genetic differentiation GST for the entire population of a small and close to 0.1.
Indicators of heterozygosity (Table. 3) for each of the local population and
different. The largest deficit was observed in heterozygotes Iglinsky local population, and the lowest - in Burzyan. Interpopulation DST smallest component of heterozygosity in Burzyan local population, and the largest - in Iglinsky. Accordingly, the minimum value of the inter-population genetic differentiation is observed in the GST Burzyan local population, and the largest - in Iglinsky.
Based on the study of polymorphism of 4 microsatellite loci were calculated inbreeding coefficients F-statistic for the entire population (tab. 4). Calculation of the index of fixation (Wright, 1965) FiS, reflecting individual inbreeding relatively subpopulation showed that in the general population there is a deficit of heterozygotes. Index fixing FiT, reflecting inbreeding individuals relative to the whole general population, also showed a deficit of heterozygotes in the general population, but at a higher level. Index fixing FST, reflecting inbreeding among subpopulations relative to the entire population of the whole, and the level of differentiation of the population showed that the population as a whole is subdivided into subpopulations.
Fixation index calculated for subpopulations were as follows (Table. 5). At least FST values ​​was subdivided Burzyan population, most subdivided Iglinskiy. The highest level of inbreeding and a lack of heterozygotes at subpopulations FiS at the level of the entire population FiT Burzyan observed in the population, and the lowest - in yusvenskoy population. In Iglinsky outbreeding populations observed excess of heterozygotes.
Based on standard genetic distances (Nei, 1978) according to an analysis of polymorphism locus COI-COII mitochondrial DNA and microsatellite loci ap243, 4a110, a24 and a8 dendrogram was constructed (Fig. 1) using the cluster analysis method of the nearest neighbor using as measures Ward's method of communication, and measures the distance - Euclidean distance. In the dendrogram observed distribution of local populations into two clusters, where the most hybridized Iglinskiy population is grouped separately from the other two. A similar pattern of distribution of local populations observed in the case of the analysis of only the nuclear DNA microsatellite loci.
Our analysis of the genetic structure of three widely separated local populations of the honey bee South and Middle Urals demonstrated their genetic differentiation and division into sub-population as a whole. There was a joint group yusvenskoy honeybee population with Burzyan, which was previously determined on the basis of genetic research as the population of Central bee Apis mellifera mellifera. This indicates the origin of the local population yusvenskoy honeybee on nuclear and mitochondrial DNA from the subspecies Ammellifera. Previously defined on the basis of genetic studies hybrid Iglinskiy local honeybee population in this study has a separate. It should be noted characteristic of the majority populations of the honey bee in the Urals small deficit of heterozygotes and inbreeding. Hybrid Iglinskiy population, by contrast, is characterized by an excess of heterozygotes and outbreeding. Thus, in the South (Burzyan district of Bashkortostan) and the Middle Urals (Yusvensky region of Komi-Perm district of the Perm region) is still preserved local populations of the honey bee subspecies Ammellifera with enough for a long time the existence of a population the size of the area and population.
  092. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Проблемы пчеловодства Республики Башкортостан. Материалы международной научно-практической конференции "Биологические ресурсы". Киров. 2010. С. 73-75.  

ПРОБЛЕМЫ ПЧЕЛОВОДСТВА РЕСПУБЛИКИ БАШКОРТОСТАН Р.А.Ильясов, А.В.Поскряков, А.Г.Николенко
Институт биохимии и генетики Уфимского научного центра РАН 450054, Россия, Башкортостан, г. Уфа, Пр. Октября, 71 e-mail: apismell@hotmail.com
В животноводстве одним из эффективных способов повышения жизнеспособности и продуктивности сельскохозяйственных животных служит скрещивание географически и экологически отдаленных подвидов. При этом получают гетерозисные гибриды, которые по хозяйственным признакам значительно превосходит своих родителей. Этим пользуются и в пчеловодстве, когда продуктивность гибридных пчел выше, чем чистопородных, на 20-40% что отражено в работах А.Ф. Губина (1936), В.В. Алпатова (1945) и М.И. Доморацкого (1948). Такое мнение в свое время дало основание говорить о необходимости внедрения в производство гибридных пчел первого поколения.
Первые плановые работы по качественному улучшению башкирских пчел относились к 1931 году, когда на базе 80 колхозных пасек лесостепной зоны Башкирская зональная опытная станция пчеловодства занялась созданием племенных пасек по разведению пчел среднерусской расы (Дулькин с соавт., 1953, 1959). В эти же годы в Республике Башкортостан приступили к сравнительному испытанию различных подвидов пчел и их гибридизации. По данным Г.А. Аветисяна (1935), гибриды первого поколения местных пчел Apis mellifera mellifera L. с южными подвидами в Республике Башкортостан оказались продуктивнее местных на 49%. А.Ф. Рахимкулов (1960) сообщает, что в условиях среднего медосбора с полевых и лесных медоносов Благовещенского района РБ гибридные пчелы давали на 20-30 кг меда больше, чем местные. А.Н. Биктимиров (1963), наблюдая за работой кавказских пчел Республике Башкортостан в период с 1958 по 1962 год, отметил, что при медосборе с луговых и полевых медоносов гибридные пчелы по продуктивности превосходили местных на 80%, но по зимостойкости уступали последним.
В результате многолетних (1965-1974) опытов по испытанию завозных южных подвидов (кавказские, карпатские, итальянские) пчел и их гибридов в Республике Башкортостан исследователями В.Н. Власовым и Г.К. Косаревым (1980) установлено, что имеются определенные различия в летной и медособирательной работе, развитии и продуктивности семей в зависимости от медосборных условий по природным зонам. Так, в лесостепной и степной зонах гибридные кавказские и итальянские пчелы по нагрузке медового зобика и общему приносу нектара достоверно превышали пчел местного подвида, тогда как при медосборе с липы превосходство наблюдалось у местных пчел среднерусской расы Apis mellifera mellifera. В дальнейшем, в ходе разработки плана породного районирования медоносных пчел СССР в условиях республики Башкортостан проводили сравнительные испытания местных пчел, пчел южных рас и их гибридов (Биктимиров, 1963; Джапаридзе, 1988). В основу данной работы по сравнительной оценке использования рас пчел была положена методика, разработанная научно-исследовательским институтом
пчеловодства (Билаш, 1963). Первый этап испытаний (1965-1968) проводился в Казангуловском опытном хозяйстве Давлекановского района и в колхозе им. Куйбышева Альшеевского района (1967-1968). На втором этапе (1970-1972) испытывали перспективные для степного взятка семьи пчел - гибридов первого поколения (местных с серыми горными кавказскими).
В 1965-1970гг. на Башкирской опытной станции пчеловодства (БОСП) проводились породные испытания гибридов от скрещивания итальянских пчел с местными. По результатам наблюдений они собрали меда на 51% больше, чем местные среднерусские, но последующие поколения гибридов, по сравнению с родительскими особями, не давали положительных результатов. А. А. Юрьев же (1969) отмечал, что привезенные с Кавказа на Урал пчелы по медо- и воскопродуктивности не превосходили местных и уступали им по зимостойкости .
Однако позже стало известно, что гетерозис проявляется не при любых скрещиваниях пчел и зависит от направления скрещивания (Жданов, 1970; Бородачев и Бородачева, 1982). Уменьшение жизнеспособности и
продуктивности гибридных пчел является результатом гибридного дисгенеза. Бесконтрольная гибридизация пчел среднерусской расы с южными, чувствительными к низким температурам, подвидами пчел является одной из основных причин гибели и ослабления пчелиных семей в зимне-весенний период и одной из важнейших проблем пчеловодства (Черевко, Черевко, 1998). За последние двадцать лет в республике Башкортостан почти ежегодно принимались программы по сохранению башкирской пчелы Apis mellifera mellifera. Однако генофонд башкирской пчелы продолжал находиться в состоянии глубокой гибридизации. Ежегодно в республике Башкортостан погибало не менее 8-10% всех семей, т.е. около 15-20 тысяч (Косарев, 1989).
Скоро неудачный эксперимент по массовому улучшению аборигенных подвидов пчел был прерван. В 1958 году организован Прибельский филиал Башкирского заповедника по сохранению аборигенных бортевых пчел (Тахаев, 1959). В 1986 г. он был преобразован в самостоятельный заповедник «Шульган- Таш». Заповедник расположен на юге Республики Башкортостан в пределах Бурзянского административного района, и по своему географическому положению относится к Центральному горному району Южного Урала. Заповедник находится в западной части данного района, имеет сложную вытянутую конфигурацию границ, расположен между реками Белая и Нугуш в пределах 5300Г-53015’ с.ш. и 56053,-57007’ в.д. Протяженность территории с севера на юг составляет 26 км, с запада на восток - 15 км, а общая площадь составляет 22531 га.
В 1959 г. в России были приняты меры по охране A.m.mellifera. По решению Технического совета Министерства сельского хозяйства РСФСР от 20 октября 1959 году была запрещена интродукция пчел из южных районов в северные - Сибирь и Урал. В 1974-1983 годы БОСП занималась проблемой массовой репродукции маток. Ими были разработаны технологии репродукции маток, которые испытывались в 10 хозяйствах республики, а также созданы 4 специализированные пасеки в крупных пчелосовхозах с объемом воспроизводства 28-32 тыс. чистопородных неоплодотворенных маток за сезон.
Также за период с 1981 по 1985 гг. БОСП были проведены экспедиции по территории Республики Башкортостан с целью поиска и завоза лучших семей башкирской популяции среднерусской расы на территорию Иглинского района для создания племенных пасек. За этот период на станцию было завезено более 200 семей, организованы 2 племенные пасеки и начаты работы по аналитической селекции (Газизов, 1987).
Сохранению бортевых пчелиных семей в условиях Бурзянского района благоприятствовали климатические условия и хорошая естественная кормовая база - большие массивы липы, клена, ивы и разнообразная травянистая медоносная растительность. Бурзянский район является одним из самых отдаленных и изолированных в Республике Башкортостан. Долгое время туда практически не было проложено хороших дорог и этот район до сих пор остается самым малозаселенным в Республике. Его изоляции способствует также расположение в горно-лесной зоне Южного Урала. В гористой местности Бурзянского района конец цветения одного растения на южном склоне совпадает с началом цветения на северном склоне. На протяжении 200-210 дней суровой зимы с морозами, нередко достигающими 45°С, семьи чувствуют себя нормально, весной в них бывает небольшое количество подмора. Бортевые пчелы меньше страдают от пади в зимних кормах по сравнению с пчелами, которые находятся в зимовниках. Очистительный облет весной они делают раньше и при более низкой температуре (Шакиров, 1992; Власов, 1996).
В период 2000-2009 гг. наша лаборатория в составе института биохимии и генетики Уфимского научного центра РАН проводила молекулярногенетические исследования медоносной пчелы в республике Башкортостан. В основу метода исследования был заложен полиморфизм микросателлитных локусов ядерной ДНК и некоторых локусов мтДНК (Ильясов с соавт., 2007). Мы показали, что на территории республики Башкортостан еще сохранилось несколько больших массивов населения медоносной пчелы среднерусской расы Apis mellifera mellifera. На данный момент один из них занимает обширную северную область республики, другой - горную юго-восточную область республики Башкортостан. Следует отметить, что население пчел северной области значительно превосходит по распространенности население пчел юговосточной горной области. Кроме того, имеется очень прерывистый ареал Apis mellifera mellifera в центральных и западных областях республики Башкортостан. С большой уверенностью можно сказать, что население пчел юго-восточной горной области относится к популяционной системе, тогда как население пчел других областей - к метапопуляции. Таким образом, республика Башкортостан на современном этапе развития обладает мощным резервным потенциалом для восстановления популяции аборигенных среднерусских пчел в ареалах, разорванных процессом гибридизации как на собственной территории, так и территории других северных регионов.
BEE PROBLEMS BASHKORTOSTAN R.A.Ilyasov, A.V.Poskryakov, A.G.Nikolenko
Institute of Biochemistry and Genetics, Ufa Scientific Center, RAS 450054, Russia, Bashkortostan, Ufa, pr. Oct. 71 e-mail: apismell@hotmail.com
In animal an effective way to improve the viability and productivity of farm animals is a crossing of geographically remote and environmentally subspecies. This produces heterosis hybrids that on economic grounds far exceeds their parents. This is used in beekeeping when the productivity of hybrid bee higher than pure-bred, by 20-40%, which is reflected in the works of AF Gubin (1936), VV Alpatov (1945) and MI Domoratskogo (1948). Such an opinion at the time gave reason to talk about the need to introduce in the production of hybrid of the first generation of bees.
The first plan of work for the qualitative improvement of the Bashkir bees belonged to 1931, when on the basis of collective 80 apiaries steppe zone Bashkir zonal experimental station of beekeeping engaged in the creation of breeding apiaries for breeding bees of Central Race (Dulkin et al., 1953, 1959). In the same years in the Republic of Bashkortostan started to comparative tests of different subspecies of bees and their hybridization. According to GA Avetisyan (1935), the first generation hybrids local bee Apis mellifera mellifera L. from southern subspecies in the Republic of Bashkortostan have been productive local 49%. AF Rakhimkulov (1960) reports that in the average honey yield from field and forest honey plants Annunciation district RB hybrid bees gave 20-30 kg of honey more than local. AN Biktimirov (1963), observing the work of the Caucasian bees Republic of Bashkortostan in the period from 1958 to 1962, noted that the honey harvest with meadow and field hybrid bee honey plants on the productivity of local superior for 80%, but conceded last winter hardiness.
As a result of long-term (1965-1974) experiments on testing imported southern subspecies (Caucasus, Carpathian, Italian) of bees and their hybrids in the Republic of Bashkortostan researchers VN Vlasov and GK Kosarev (1980) found that there are certain differences in summer and medosobiratelnoy work, development and productivity of families depending on medosbornyh conditions of natural areas. Thus, in the forest-steppe and steppe zones of hybrid Caucasian and Italian bees on honey zobika load and brings the total of nectar bees significantly exceed the local subspecies, whereas with linden honey yield superiority was observed in native bees of Central race Apis mellifera mellifera. Later, during the development of the breed regionalization plan honeybees USSR in the Republic of Bashkortostan conducted comparative tests of native bees, bees southern races and their hybrids (Biktimirov, 1963; Japaridze, 1988). This paper is based on the comparative assessment of the races of bees were based on a procedure developed by a research institute
Beekeeping (Bilash, 1963). The first stage of testing (1965-1968) was held in Kazangulovskom Davlekanovskiy experimental farm area and the farm to them. Alsheevsky Kuibyshev district (1967-1968). In the second phase (1970-1972) experienced perspective to bribe steppe family of bees - the first generation hybrids (local gray mountain Caucasian).
In 1965-1970gg. Bashkir Bee Research Station (VSDB) tests were conducted breed hybrids by crossing Italian bees with the locals. According to the results of observations of honey they collected 51% more than the local Central Russian, but the next generation of hybrids compared with parental individuals, did not give positive results. A. Yuryev same (1969) noted that imported from the Caucasus to the Ural bee on medo- voskoproduktivnosti and do not exceed local and inferior to them in winter hardiness.
However, later it became known that heterosis is manifested not in any crosses bees and depends on the direction crossing (Zhdanov, 1970; bearded Borodacheva, 1982). Reducing the viability and
productivity is a result of hybrid bees hybrid dysgenesis. Uncontrolled hybridization bees of Central race with southern sensitive to low temperatures, bee subspecies is one of the major causes of death and the weakening of bee colonies in winter and spring, and one of the major problems of beekeeping (Cherevko, Cherevko, 1998). Over the past twenty years in the Republic of Bashkortostan adopted almost every year of the program for the conservation of Bashkir bee Apis mellifera mellifera. However, the gene pool of the Bashkir bee continued to be in a state of deep hybridization. Every year in the republic of Bashkortostan perished at least 8-10% of all families, ie 15-20 thousand (Kosarev, 1989).
Soon the failed experiment of massive improvement subspecies native bees was interrupted. In 1958 he organized a branch of the Bashkir Pribelsky reserve on conservation of native wild-hive bee (Taha 1959). In 1986 it was transformed into an independent reserve "Shulgan- Tash." The reserve is located in the south of the Republic of Bashkortostan within Burzyansky Administrative Region, and its geographical location refers to the central highlands of the Southern Urals. The reserve is located in the western part of the region, it has a complex configuration of the extended boundaries, located between the rivers White and Nugush within 5300G-53015 'N and 56053, -57007 'E. The length of the territory from north to south is 26 km, from west to east - 15 km and a total area of ​​22531 hectares.
In 1959, Russia adopted measures to protect Ammellifera. According to the decision of the Technical Council of the Ministry of Agriculture of the Russian Federation dated 20 October 1959, prohibited the introduction of bees from southern to northern - Siberia and the Urals. In 1974-1983 years he worked VSDB problem of mass reproduction of queens. They have developed technology of reproduction of queens, which were tested in 10 farms of the republic, as well as create 4 specialized in large apiary pchelosovhozah with a volume of 28-32 thousand reproduction. Infertile thoroughbred mares per season.
Also, for the period from 1981 to 1985. VSDB expeditions were conducted on the territory of the Republic of Bashkortostan for the purpose of search and delivery of the best families of the Bashkir population of the territory of Central race iglinsky district to create a breeding apiaries. During this period, the station was brought more than 200 families, organized two tribal apiary and started work on analytical selection (Gazizov, 1987).
Conservation of wild-hive bee colonies under Burzyansky district favored climatic conditions and good natural food supply - large amounts of lime, maple, willow and diverse herbaceous vegetation honey. Burzyan area is one of the most remote and isolated in the Republic of Bashkortostan. For a long time there was virtually no good roads paved and the area still remains the most sparsely populated in the country. It also contributes to the isolation location in the mountain forest zone of Southern Urals. In mountainous terrain Burzyansky district end of flowering plants on the southern slope coincides with the beginning of flowering on the northern slope. For 200-210 days of severe winter frosts, often reaching 45 ° C, the family feel good spring in them is a small amount of Podmore. Wild-hive bee suffer less from winter fodder paddy compared to bees that are in Zimovniki. Cleansing circled the spring before they do, and at a lower temperature (Shakirov, 1992; Vlasov, 1996).
In the period 2000-2009. our laboratory in the Institute of Biochemistry and Genetics, Ufa Scientific Center, Russian Academy of Sciences conducted research molekulyarnogeneticheskie honeybee in the Republic of Bashkortostan. The basis of the research method was laid polymorphism of microsatellite loci of nuclear DNA and mtDNA of some loci (Ilyasov et al., 2007). We have shown that in the territory of the Republic of Bashkortostan has survived several large arrays of honeybee populations of Central race Apis mellifera mellifera. At the moment, one of them is a vast northern region of the republic, the other - a mountain south-eastern area of ​​the Republic of Bashkortostan. It should be noted that the population of bees the northern region is significantly superior to the prevalence of the population of bees southeastern mountain region. In addition, there is a very intermittent area Apis mellifera mellifera in the central and western regions of the Republic of Bashkortostan. With great confidence we can say that the bee population of the southeastern mountain region refers to the system of population, whereas the population of bees other areas - a metapopulation. Thus, the Republic of Bashkortostan at the present stage of development has a powerful backup capabilities for restoring populations of native bees in Central Russia resorts, broken hybridization process on its own territory, and in other northern regions.
  091. Ильясов Р.А., Фахретдинова С.А., Поскряков А.В., Николенко А.Г. Генетическая структура бурзянской популяции медоносной пчелы Apis mellifera mellifera L. Материалы I международных Беккеровских чтений. Волгоград. 2010. С. 46-50.  

Медоносная пчела подвида Apis mellifera mellifera L. является аборигенной для республики Башкортостан. Наиболее известная популяция медоносной пчелы этого подвида - бурзянская, характеризующаяся наличием большого числа бортевых семей. Для сохранения этой пчелы необходима разметка границ ее ареала. В данной работе мы на основе анализа межгенного локуса COI-COII мтДНК, локуса ND2 мтДНК и микросателлитных локусов ap243, 4a110, ap049, a24 ядерной ДНК показали, что популяция до сих пор сохранилась чистопородной, а ее границы, возможно, распространятся за пределы административных границ района на север в сторону Белорецкого района и на юг в сторону Зилаирского района республики Башкортостан. Для бурзянской популяции медоносной пчелы характерен небольшой уровень инбридинга.
Honeybee subspecies Apis mellifera mellifera L. is a native of the Republic of Bashkortostan. The best known of the honey bee population of this subspecies - Burzyan characterized by the presence of a large number of family tree hollow. To save the bees need this marking the boundaries of its range. In this paper, we based on the analysis of intergenic locus COI-COII mtDNA locus ND2 mtDNA and microsatellite loci ap243, 4a110, ap049, a24 nuclear DNA showed that the population is still kept purebred and its boundaries may spread beyond administrative boundaries district north towards the Beloretsk area and south towards Zilair district of Bashkortostan. For Burzyan honeybee populations typical small level of inbreeding.
  090. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Генное разнообразие и коэффициенты инбридинга медоносной пчелы в локальной популяции на севере Республики Башкортостан. Материалы всероссийской научно-практической конференции "Полевые и экспериментальные исследования биологических систем". Ишим. 2010. C.66-68.  

Нами были изучены пчелы с 42 пасек трех северных районов (Бирский, Караидельский, Мишкинский). Всего было проанализировано по микросателлитным локусам ар243, 4а110 и А8 ядерной ДНК пчел из 211 семей исследуемых районов Республики Башкортостан. В изучаемой выборке пчел нами были рассчитаны F-коэффициенты и гетерозиготность. Использование в анализе F-коэффициентов и гетерозиготностей позволяет наиболее полноценно и всесторонне охарактеризовать популяции и сравнивать их с аналогичными показателями других популяций. Кроме того, эти характеристики позволяют говорить о процессах, происходящих в популяции и прогнозировать дальнейшую динамику популяции. Анализ средних значений последних по микросателлитным локусам ap243, 4a110 и А8 ядерной ДНК (Табл. 1) показал, что популяция северного ареала башкирской пчелы характеризуется низким уровнем генетической дифференциации (FST=0,015) между субпопуляциями, что свидетельствует о возможном единстве происхождения пчел из этих популяций.
Близкие к нулю значения коэффициентов инбридинга (FIS=0,122 и FIT=0,135) и близкие значения наблюдаемой (HО=0,435) и ожидаемых (HS=0,485 и HТ=0,493) показателей гетерозиготности отражают баланс между инбридингом и аутбридингом, как в отдельных субпопуляциях, так и во всей популяции, в целом, а также свидетельствуют о том, что распределение генотипов по всем локусам приближается к равновесному по Харди-Вайнбергу. Такое равновесное состояние дает возможность длительного существования популяции в современных неизменных условиях окружающей среды.
Таким образом, популяция северного ареала башкирской пчелы A.m.mellifera характеризуется отсутствием подразделенности между населениями пчел Бирского, Караидельского и Мишкинского районов. Минимальное отклонение от равновесия Харди-Вайнберга свидетельствует об устойчивости популяции во времени и незначительном влиянии на нее факторов эволюции. Наблюдаемые коэффициенты инбридинга в популяции можно принять за оптимальные равновесные значения, которые сложились в течение продолжительного времени становления северной популяции A.m.mellifera, которые можно использовать в сравнении с другими популяциями.
We have studied bees with 42 apiaries three northern regions (Birsky, Karaidelsky, Mishkinskoye). There were analyzed for microsatellite loci ar243, 4a110 and A8 nuclear DNA of 211 families of bees studied areas of the Republic of Bashkortostan. In our sample of bees we calculated F-ratios and heterozygosity. Using the analysis of F-ratios and heterozygous allows most fully and comprehensively characterize the population, and to compare them with those of other populations. In addition, these characteristics allow us to speak about the processes occurring in the population and to predict the future dynamics of the population. Analysis of the average of the last of microsatellite loci ap243, 4a110 A8 and nuclear DNA (Table. 1) showed that the population of the northern area of ​​the Bashkir bee is characterized by a low level of genetic differentiation (FST = 0,015) between subpopulations, suggesting a possible common origin of these populations of bees .
Near-zero coefficient of inbreeding (FIS = 0,122 and FIT = 0,135) and similar values ​​observed (HO = 0.435) and expected (HS = 0,485 and HT = 0.493) heterozygosity indices reflect a balance between inbreeding and outbreeding, in certain subpopulations, as and in the population as a whole, as well as evidence that the distribution of genotypes at all loci close to the equilibrium of Hardy-Weinberg equilibrium. This equilibrium state allows continued existence of the population in modern constant environmental conditions.
Thus, the population of the northern area of ​​the Bashkir bee Ammellifera characterized by lack of division between the population of bees Birsk, Karaidelskogo and Mishkinsky areas. Minimum deviation from Hardy-Weinberg equilibrium demonstrates the stability of the population in time and insignificant effect on her evolutionary factors. The observed rates of inbreeding in the population can be taken for optimal equilibrium values ​​that have been established for a long time the formation of northern populations Ammellifera, which can be used in comparison with other populations.
  089. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Молекулярная характеристика населения медоносной пчелы центральной части республики Башкортостан на основе анализа микросателлитных локусов // Экологический мониторинг и биоразнообразие. Т.5. №1. 2010. C 65-68.

В работе нами были проанализированы медоносные пчелы из 32 семей Иглинского района (3 пасеки: с.Улу-Теляк, пасека Кугейко; с.Улу-Теляк, пасека Громова; с.Улу-Теляк, БОСП, пасека матковыводная), 17 семей Альшеевского района (3 пасеки: с.Никифарово, пасека Юсуповой Р.; с.Раевка, пасека Пискарева М.П.; с.Раевка, пасека Селезнева Б.), 51 семьи Бирского района (10 пасек: д. Угузево, пасека Сафина А.Ф.; г.Бирск, пасека Черенкова В.С.; г.Бирск, пасека Сайфутдинова Е.В.; д.Осиновка, пасека Черникова Ю.П.; д.Акуди, пасека Яикбаева А.А.; д.Печенкино, пасека Габитова И.Р.; д.Улеево, пасека Янситова В.В.; д.Кондаковка, пасека Акмурзина Е.Н.; д.Вязовка, пасека Лепустина И.А.; д.Бахтыбаево, пасека Кутлусатова М.П.), собранные в период 2004-2008 гг. Всего нами были проанализированы медоносные пчелы из 100 семей пчел трех районов центральной части республики Башкортостан (Иглинский, Альшеевский и Бирский). В популяционном анализе были использованы 4 микросателлитных локуса Ap243, 4a110, A24, A8 (Estoup et al., 1995; Solignac et al. 2003). По наблюдаемой частоте аллелей были рассчитаны генетические расстояния Cavalli-Sforza, Edwards (1967) (Табл. 1) и построена дендрограмма (Рис. 1). Население медоносной пчелы Альшеевского района на дендрограмме располагается отдаленно от двух других популяций, что свидетельствует о преобладании потока генов между населениями медоносной пчелы Иглинского и Бирского районов над потоком между каждым из вышеназванных населений и населением Альшеевского района. Население медоносной пчелы Иглинского и Бирского районов ранее по митохондриальной ДНК были отнесены к гибридным и среднерусским A.m.mellifera, соответственно, и их совместная группировка произошла благодаря вкладу северной популяции башкирской медоносной пчелы в создание населения пчел Иглинского района. Кроме того, произошедший завоз семей пчел из гибридизованных пасек Иглинского района в Бирский район также мог привести их к генетическому сближению.
По значениям коэффициентов инбридинга Fis, Fit (Табл. 2) в населении медоносной пчелы центральной части республики Башкортостан отмечается преобладание близкородственного скрещивания над отдаленным. А значение коэффициента инбридинга Fst показывает об отсутствии подразделенности – это говорит о высоком уровне миграции населения медоносной пчелы центральной части республики Башкортостан.
Таким образом, население медоносной пчелы центральной части республики Башкортостан характеризуется отсутствием определенной генетической структурированности, преобладанием инбридинга над аутбридингом. Поток генов между населениями медоносной пчелы увеличивается с уменьшением расстояния между ними. Генетическое родство населений медоносной пчелы разных районов обусловлено миграцией семей между ними. Характеристики F-статистики свидетельствуют о максимальном приближении населения медоносной пчелы центральной части республики Башкортостан в целом к равновесному состоянию и о небольшом снижении устойчивости генофонда к внешним воздействиям.
In this paper we analyzed honeybees from 32 families iglinsky district (3 apiary: s.Ulu-Telyak, apiary Kugeiko; s.Ulu-Telyak, apiary Gromov; s.Ulu-Telyak, VSDB, apiary matkovyvodnaya), 17 families Alsheevsky area (3 apiary: s.Nikifarovo, P .; apiary Yusupova s.Raevka, apiary Piskareva MP .; s.Raevka, apiary Seleznev BI), 51 family Birsk area (10 apiaries: d. Uguzevo, apiary Safina A. F .; g.Birsk, apiary VS Cherenkov .; g.Birsk, apiary Sayfutdinova EV .; d.Osinovka, apiary Chernikov YP .; d.Akudi, apiary Yaikbaeva AA d.Pechenkino .; , apiary Gabitova I.R .; d.Uleevo, apiary Yansitova VV .; d.Kondakovka, apiary Akmurzina EH .; d.Vyazovka, apiary Lepustina IA .; d.Bahtybaevo, apiary Kutlusatova MP .) collected in 2004-2008. In total we analyzed honey bees from 100 bee colonies in the three districts of the central part of the republic of Bashkortostan (Iglinskiy, Alsheevsky and Birsky). The population analysis were used 4 microsatellite loci Ap243, 4a110, A24, A8 (Estoup et al., 1995; Solignac et al. 2003). According to the observed allele frequencies were calculated genetic distances Cavalli-Sforza, Edwards (1967) (Table. 1) and is constructed dendrogram (Fig. 1). The population of the honeybee Alsheevsky area on the dendrogram is distant from the other two populations, indicating that the prevalence of gene flow between the populations of the honey bee and Iglinskiy Birsk areas over the flow between each of the above populations and populations Alsheevsky area. The population of the honeybee and Iglinskiy Birsk areas earlier on mitochondrial DNA have been attributed to hybrid and Srednerussky Ammellifera, respectively, and the joint group was due to the contribution of the northern population of the Bashkir honey bee population of bees in creating iglinsky district. In addition, the delivery of which occurred bee colonies hybridized from apiaries iglinsky district Birsk area could also lead them to the genetic convergence.
From the values ​​of coefficients of inbreeding Fis, Fit (Tab. 2) in the honey bee population of the central part of the republic of Bashkortostan marked predominance of inbreeding on the remote. A coefficient of inbreeding Fst indicates the absence of division - this shows a high level of migration of the honey bee population of the central part of the republic of Bashkortostan.
Thus, the honey bee population of the central part of the Republic of Bashkortostan is characterized by the absence of certain genetic structuring, the prevalence of inbreeding outbreeding. Gene flow between the populations of the honey bee increases with decreasing distance between them. Genetic relatedness honeybee populations of different areas due to migration between the two families. Features F-statistics show extreme close honey bee population of the central part of the Republic of Bashkortostan as a whole to equilibrium and a slight decrease in the stability of the gene pool to external influences.
Microsatellite loci is fine tools in population researches. We analysed honey bees population from 100 colonies of three regions of central part of Bashkortostan republic using microsatellite loci Ap243, 4a110, A24, A8. We shown that honey bee population have not exact structuredness. F-statistics shown little prevalence inbreeding on autbreeding. That characteristics witness about maximal approach to equilibrium condition.
  088. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Эволюция и филогенетика медоносной пчелы Урала. Материалы международной научной конференции "Проблемы экологии. Чтения памяти профессора М.М.Кожова". Иркутск. 2010. С. 248.  

Для решения вопросов о подвидах медоносной пчелы, биогеографии и филогенетики наиболее удобно сравнительное изучение последовательности региона мтДНК, охватывающего часть второй субъединицы NADH дегидрогеназы (ND2) и тРНК изолейцина (tRNA ILE). В ходе секвенционного анализа амплифицированного фрагмента гена ND2 мтДНК медоносной пчелы была определена его нуклеотидная последовательность со средним размером 688 п.н. Нуклеотид-ные последовательности просеквенированных фрагментов гена ND2 мтДНК пчел были депонированы в международный генбанк NCBI.
На дендрограмме, построенной по результатам сравнения нуклеотидных последовательно-стей фрагмента гена ND2 не наблюдалось большой дифференциации между представителями населений медоносной пчелы A.m.mellifera разных регионов на Урале (Бурзянский, Татышлин-ский, Бирский районы республики Башкортостан и Крсновишерский, Частинский, Нытвенский и Осинский районы Премского края), что является показателем их тесного генетического родства. Представители уральских и европейских популяций A.m.mellifera кластеризовались в одну группу, названную эволюционной ветвью М. Но от ветви М, предложенной F.Ruttner et al. (1988), она отличалась тем, что в ее состав вошел только один единственный подвид - A.m.mellifera.
Большинство представителей африканских подвидов пчел вошли во вторую группу, названную эволюционной ветвью А, по аналогии с F.Ruttner et al. (1988), хотя по составу подвидов наблюдались определенные различия. Эта ветвь разделилась на две подгруппы, объединяющие северо-африканские и южно-африканские подвиды, что сходно с группировкой M.C.Arias, W.S.Sheppard (1996). Однако, в отличие от группировки последних авторов, мы еще наблюдали третью африканскую группу, объединяющую пчел Центральной Африки - Apis mellifera adansonii Latreille из Сенегала и Apis mellifera scutellata Lepeletier из Кении. От основания ветви А отделилась небольшая группа, куда вошли Apis mellifera meda Skorikov из Сирии, Apis mellifera syriaca Buttel-Reepen из Сирии и Apis mellifera lamarckii Cockerell из Египта, названная эволюционной ветвью О. В четвертую многочисленную группу, названную эволюционной ветвью С, вошли пчелы Средиземноморья, Ближнего Востока и Кавказа.
В дальнейшем мы планируем включить в филогенетический анализ население медоносной пчелы Apis mellifera республик Удмуртия и Татарстан, Свердловской и Челябинской областей.
To address questions about the honey bee subspecies, biogeography and phylogeny most convenient comparative study of mtDNA sequences in the region, covering part of the second subunit of NADH dehydrogenase (ND2) and isoleucine tRNA (tRNA ILE). During sekventsionnogo analysis amplified gene fragment ND2 mtDNA honeybee was determined its nucleotide sequence with an average size of 688 bp Nucleotide sequences sequenced gene fragments ND2 mtDNA bees were deposited at an international genebank NCBI.
In the dendrogram constructed by comparing the nucleotide sequence-gene fragment ND2 stey was no big differentiation between the populations of the honey bee Ammellifera different regions of the Urals (Burzyan, Tatyshlin-sky, Birsky districts of the republic of Bashkortostan and Krsnovishersky, Chastinsky, Nytva and Osa region Premskogo Territory), which is an indicator of their close genetic relationship. The representatives of the Ural and European populations Ammellifera clustered into one group called evolutionary branch from the branch M. But M proposed F.Ruttner et al. (1988), it is different in that its composition entered only a single subspecies - Ammellifera.
Most of the African subspecies of bees included in the second group, called evolutionary branch A, by analogy with the F.Ruttner et al. (1988), although the composition of certain subtypes observed differences. This branch was divided into two subgroups, combining North African and South African subspecies, which is similar to grouping MCArias, WSSheppard (1996). However, unlike the latter group of authors, we have seen a third of the African Group combining the Central African bees - Apis mellifera adansonii Latreille from Senegal and Apis mellifera scutellata Lepeletier from Kenya. From the base of the branches and the Division of a small group which included Apis mellifera meda Skorikov Syria, Apis mellifera syriaca Buttel-Reepen from Syria and Apis mellifera lamarckii Cockerell of Egypt, called evolutionary branch A. The fourth largest group, called evolutionary branch C includes bees Mediterranean, the Middle East and the Caucasus.
In the future, we plan to include in the phylogenetic analysis of the population of the honeybee Apis mellifera republics of Udmurtia and Tatarstan, Sverdlovsk and Chelyabinsk regions.
  087. Салтыкова Е.С., Гайфуллина Л.Р., Ильясов Р.А., Николенко А.Г. Действие хитозана на индукцию основных антибактериальных пептидов у медоносной пчелы. Материалы Десятой Международной конференции "Современные перспективы в исследовании хитина и хитозана". Нижний новгород. 2010. С. 308-310.  

Проводился анализ изменения экспрессии антимикробных пептидов дефенсин и абецин под влиянием подкормки сахарным сиропом с хитозаном. Было показано увеличение уровня экспрессии генов антимикробных пептидов под влиянием хитозана примерно в 2 раза, что свидетельствует о роли хитозана в организме медоносной пчелы в повышении иммунитета и адаптированности к условиям окружающей среды.
Антимикробные пептиды (АМП) в организме медоносной пчелы играют важную роль в иммунитете и выживаемости. Два наиболее известных из них дефензин и абецин. Нами был проведен ПЦР в режиме реального времени по результатам поставленного эксперимента при однократном кормлении пчел 0,001% раствором хитозана. После кормления пчел экстрагировалась мРНК, на основе которой синтезировалась кДНК для последующей ПЦР в режиме реального времени (ПЦР РВ). Целью нашего эксперимента стала проверка влияния хитозана на уровень экспрессии антимикробных пептидов абецина и дефензина у медоносной пчелы. Ген MGST в эксперименте использовался в качестве контроля, как ген, на экспрессию которого не должно влиять кормление хитозаном.
Нами были получены данные об уровне изменения экспрессии каждого антимикробного пептида в отдельности в двух повторностях. По результатам поставленных экспериментов после кормления пчел хитозаном можно заключить, что уровень экспрессии дефензина имеет тенденцию к увеличению на 142% (P=0,053) в 1 эксперименте и на 96% (P=0,033) во 2 эксперименте. Уровень экспрессии абецина увеличился на 188% (P<0,001) в 1 эксперименте и на 100% (P<0,001) во 2 эксперименте.
Таким образом, можно предположить, что однократное кормления пчел 0,001% раствором хитозана приводит к заметному увеличению уровня экспрессии антимикробных пептидов дефензина (в 2-2,8 раз) и абецина (в 1,9-2,4 раза) в организме медоносной пчелы Apis mellifera mellifera.
Analyzed changes in the expression of antimicrobial peptides of defensin and abetsin influenced by feeding sugar syrup with chitosan. It has been shown to increase the level of gene expression of antimicrobial peptides under the influence of chitosan is about 2 times, indicating that the role of chitosan in the body of the honeybee in improving immunity and adaptability to environmental conditions.
Antimicrobial peptides (AMPs) in the body of the honeybee play an important role in immunity and survival. The two most prominent of these defensin and abetsin. We carried out the PCR in real time from the results of the experiment with a single staged feeding of bees 0.001% solution of chitosan. After feeding, the bees extracted mRNA from which the cDNA was synthesized for subsequent PCR in real time (real-time PCR). The purpose of our experiment was to check the effect of chitosan on the level of expression of antimicrobial peptides and abetsina defensin in the honeybee. MGST gene used in the experiment as a control as the gene for expression of which should not affect feeding chitosan.
We obtained data on the changes in the expression level of each of the antimicrobial peptide separately in duplicate. According to the results of experiments set after feeding bees chitosan it can be concluded that the expression level of defensin tends to increase by 142% (P = 0,053) in one experiment and by 96% (P = 0,033) in the two experiments. The expression level of abetsina increased by 188% (P <0,001) in experiment 1 and 100% (P <0,001) in the 2nd experiment.
Thus, it can be assumed that a single foraging bees 0.001% chitosan solution leads to a marked increase in the level of expression of defensin antimicrobial peptides (in 2-2,8 times) abetsina (a 1.9-2.4-fold) in the body of the honeybee Apis mellifera mellifera.
  086. Ильясов Р.А., Петухов А.В., Поскряков А.В., Николенко А.Г. Популяция медоносной пчелы Среднего и Южного Урала. Материалы VIII Межрегионального совещания энтомологов Сибири и Дальнего Востока "Энтомологические исследования в Северной Азии". Новосибирск. 2010. C. 91-93.  

Нами были собраны медоносные пчелы Apis mellifera из 43 семей с 2 пасек заповедника Шульган-Таш Бурзянского района республики Башкортостан (пасека Капова-Пещера кордон заповедника; пасека п.Коран-Елга), из 52 семей с 6 пасек Башкирской опытной станции пчеловодства Иглинского района республики Башкортостан (п.Улу-Теляк, пасека Гареева; п.Улу-Теляк, пасека матковыводная; п.Улу-Теляк, пасека Орловская; п.Улу-Теляк, пасека Кугейко; п.Улу-Теляк, пасека Громова; п.Улу-Теляк, пасека Шамсуринская), из 37 семей с 8 пасек Юсьвенского района Коми-Премяцкого округа Пермского края (с.Архангельское, пасека Кривощекова Д.Ф.; с.Юсьва, пасека Быкова Н.А.; с.Почашор, пасека Сторожева В.М.; д.Федотово, пасека Власова В.Д.; д.Федорово, пасека Бояндина А.Г.; пасека д.Б.Они; пасека д.Доег; пасека д.Пожва). Всего было проанализировано 132 семьи медоносной пчелы.
Для изучения генетической структуры населения медоносной пчелы Среднего и Южного Урала мы анализировали полиморфизм локуса COI-COII митохондриальной ДНК и микросателлитных локусов ap243, 4a110, a24 и a8. В трех локальных популяциях медоносной пчелы (бурзянская, иглинская и юсьвенская) наблюдались следующие частоты аллей.
Межгенный локус COI-COII мтДНК у медоносной пчелы представлен 4 состояниями, где единственный элемент Q на Урале характеризует происхождение по материнской линии от подвидов пчел из южных регионов – A.m.caucasica, A.m.carnica, A.m.ligustica и других. Все остальные комбинации элементов P и Q на Урале характеризуют медоносную пчелу подвида A.m.mellifera по материнской линии. Бурзянская и юсьвенская популяции характеризуются максимальным содержанием пчел, происходящих от A.m.mellifera по материнской линии.
Уровень гетерозиготности является одним из основных показателей в популяционно-генетическом анализе пчел, характеризующий величину биологического и генного разнообразия. Для популяции медоносной пчелы известно, что избыточная и недостаточная гетерозиготность ведет к неблагоприятным явлениям. Для популяции медоносной пчелы в норме, по результатам наших многолетних исследований в России, свойственен небольшой дефицит гетерозигот (Ильясов с соавт., 2008). Мы рассчитали величину средней наблюдаемой гетерозиготности внутри субпопуляции HO и сравнили ее со средней ожидаемой гетерозиготностью внутри субпопуляции. Во всей популяции по всем микросателлитным локусам ядерной ДНК наблюдается дефицит гетерозигот HO (0,413) < НS (0,444). Гетерозиготность внутри субпопуляций НS (0,444) больше гетерозиготности между субпопуляциями DST (0,039). Величина межпопуляционной генетической дифференциации GST для всей популяции небольшая и приближается к значению 0,080.
Показатели гетерозиготности для каждой локальной популяции также различались. Наибольший дефицит гетерозигот наблюдался в иглинской локальной популяции HO (0,562) < НS (0,469), а наименьший - в юсьвенской HO (0,347) < НS (0,389). Межпопуляционная составляющая гетерозиготности DST наименьшая в бурзянской локальной популяции DST (0,000), а наибольшая - в иглинской DST (0,012). Соответственно, наименьшая величина межпопуляционной генетической дифференциации GST наблюдается в бурзянской локальной популяции GST (0,001), а наибольшая - в иглинской GST (0,026).
На основе изучения полиморфизма 4 микросателлитных локусов были рассчитаны коэффициенты инбридинга F-статистики для всей популяции. Расчет индекса фиксации (Wright, 1965) FIS, отражающего инбридинг особи относительно субпопуляции показал, что во всей популяции наблюдается дефицит гетерозигот FIS (0,052) > 0. Индекс фиксации FIT, отражающий инбридинг особи относительно всей общей популяции, также показал дефицит гетерозигот во всей популяции, но на более высоком уровне FIT (0,163) > 0. Индекс фиксации FST, отражающий инбридинг между субпопуляциями относительно всей целой популяции, а также уровень дифференцированности популяции показал, что популяция в целом подразделена FST (0,117) на субпопуляции.
Индексы фиксации, рассчитанные для субпопуляций были следующие. По значениям FST наименее подразделенной оказалась бурзянская популяция FST (0,001), а наиболее подразделенной иглинская FST (0,028). Наибольший уровень инбридинга и дефицит гетерозигот на уровне субпопуляций FIS и на уровне всей популяции FIT наблюдался в бурзянской популяции FIS (0,241) > 0 и FIT (0,242) > 0, а наименьший - в юсьвенской популяции FIS (0,099) > 0 и FIT (0,115) > 0. В иглинской популяции наблюдался аутбридинг с избытком гетерозигот FIS (-0,167) < 0 и FIT (-0,135) < 0.
На основе стандартных генетических расстояний (Nei, 1978) по данным анализа полиморфизма локуса COI-COII митохондриальной ДНК и микросателлитных локусов ap243, 4a110, a24 и a8 была построена дендрограмма с использованием кластерного анализа методом ближайшего соседа, используя в качестве меры связи метод Варда, а меры расстояния - Евклидову дистанцию. На дендрограмме наблюдается распределение локальных популяций на два кластера, где максимально гибридизованная иглинская популяция группируется отдельно от двух других. Сходная картина распределения локальных популяций наблюдается и в случае анализа только микросателлитных локусов ядерной ДНК.
Проведенный нами анализ генетической структуры трех удаленных друг от друга локальных популяций медоносной пчелы Южного и Среднего Урала показал их генетическую дифференциацию и подразделенность на субпопуляции в целом. Отмечалась совместная группировка юсьвенской популяции медоносной пчелы с бурзянской, которая ранее была определена на основе генетических исследований как популяция среднерусской пчелы Apis mellifera mellifera. Это свидетельствует о происхождении юсьвенской локальной популяции медоносной пчелы по ядерной и митохондриальной ДНК от подвида A.m.mellifera. Ранее определенная на основе генетических исследований гибридная иглинская локальная популяция медоносной пчелы в данном исследовании располагалась отдельно. Следует отметить характерный для большинства популяций медоносной пчелы на Урале небольшой дефицит гетерозигот и инбридинг. Гибридная иглинская популяция, наоборот, характеризуется избытком гетерозигот и аутбридингом. Таким образом, на Южном (Бурзянский район республики Башкортостан) и Среднем Урале (Юсьвенский район Коми-Пермяцкого округа Пермского края) еще сохранились локальные популяции медоносной пчелы подвида A.m.mellifera с достаточными для длительного существования популяции во времени величиной ареала и численности.
We have collected honey bees Apis mellifera out of 43 families with 2 apiaries Reserve Shulgan-Tash Burzyansky district of the republic of Bashkortostan (apiary Kapova-Cave Reserve cordon; apiary p.Koran-Elga) from 52 families with 6 Bashkir apiaries Research Station beekeeping iglinsky district of the republic Bashkortostan (p.Ulu-Telyak, apiary Gareeva; p.Ulu-Telyak, apiary matkovyvodnaya; p.Ulu-Telyak, apiary Orel; p.Ulu-Telyak, apiary Kugeiko; p.Ulu-Telyak, apiary Gromov; p.Ulu -Telyak, apiary Shamsurinskaya) from 37 families with 8 apiaries Yusvenskogo region of Komi-Perm Territory Premyatskogo County (s.Arhangelskoe, apiary Krivoshchekova DF .; s.Yusva, apiary NA Bykov .; s.Pochashor, apiary Storozheva VM .; d.Fedotovo, apiary VD Vlasov .; d.Fedorovo, apiary Boyandina AG d.B.Oni .; apiary, apiary d.Doeg; d.Pozhva apiary). There were analyzed 132 families honeybee.
To study the genetic structure of the honey bee population of the Middle and South Urals, we analyzed the polymorphism locus COI-COII mitochondrial DNA and microsatellite loci ap243, 4a110, a24 and a8. The three local populations of the honey bee (Burzyan, Iglinskiy and yusvenskaya) observed the following frequencies alleys.
Intergenic locus COI-COII mtDNA in honeybee represented 4 states, where Q is the only element in the Urals describes the origin of the maternal line of the sub-species of bees from southern regions - Amcaucasica, Amcarnica, Amligustica and others. All other combinations of elements P and Q in the Urals characterize the honeybee subspecies Ammellifera through the maternal line. Burzyan yusvenskaya population and characterized by the highest content of bees originating from Ammellifera through the maternal line.
The level of heterozygosity is one of the main indicators in the population genetic analysis of the bees, which characterizes the value of biological and genetic diversity. For the honeybee population is known that excessive and insufficient heterozygosity lead to adverse events. For the honeybee population is normal, according to the results of our many years of research in Russia peculiar small deficit of heterozygotes (Ilyasov et al., 2008). We have calculated the value of the average observed heterozygosity in a subpopulation of HO and compared it with the average expected heterozygosity in a subpopulation. In the entire population of all the nuclear DNA microsatellite loci deficient heterozygotes HO (0,413) <HS (0.444). Heterozygosity in subpopulations HS (0.444) greater heterozygosity between subpopulations DST (0,039). The value of inter-population genetic differentiation GST for the entire population of a small and close to the value of 0.080.
Indicators of heterozygosity for each local population is also different. The largest deficit of heterozygotes was observed in the local population Iglinsky HO (0,562) <HS (0.469), and the lowest - in yusvenskoy HO (0,347) <HS (0.389). Interpopulation DST smallest component of heterozygosity in Burzyan local population DST (0,000), and the highest - in Iglinsky DST (0,012). Accordingly, the minimum value of the inter-population genetic differentiation is observed in the GST Burzyan local populations GST (0,001), and the highest - in Iglinsky GST (0,026).
Based on the study of polymorphism of 4 microsatellite loci were calculated inbreeding coefficients F-statistic for the entire population. Calculation of the index of fixation (Wright, 1965) FIS, reflecting individual inbreeding relatively subpopulation showed that in the general population there is a deficit of heterozygotes FIS (0,052)> 0. The index of fixation of FIT, which reflects inbreeding individuals relative to the whole general population, also showed a deficit of heterozygotes in the general population but at a higher level FIT (0,163)> 0. Index fixing FST, reflecting inbreeding among subpopulations relative to the entire population of the whole, and the level of differentiation of the population showed that the population as a whole is divided FST (0,117) in the subpopulation.
Fixation index calculated for subpopulations were as follows. At least FST values ​​was subdivided Burzyan population FST (0,001), and the most subdivided Iglinskiy FST (0,028). The highest level of inbreeding and a lack of heterozygotes at subpopulations of FIS and the level of the whole population was observed in the FIT Burzyan population FIS (0,241)> 0 and FIT (0,242)> 0, and the lowest - in yusvenskoy population FIS (0,099)> 0 and FIT (0,115 )> 0. Iglinsky outbreeding population was observed with an excess of heterozygotes FIS (-0,167) <0 and FIT (-0,135) <0.
Based on standard genetic distances (Nei, 1978) according to an analysis of polymorphism locus COI-COII mitochondrial DNA and microsatellite loci ap243, 4a110, a24 and a8 dendrogram was constructed using the cluster analysis method of the nearest neighbor using a connection method as a measure of Ward and measure the distance - Euclidean distance. In the dendrogram observed distribution of local populations into two clusters, where the most hybridized Iglinskiy population is grouped separately from the other two. A similar pattern of distribution of local populations observed in the case of the analysis of only the nuclear DNA microsatellite loci.
Our analysis of the genetic structure of three widely separated local populations of the honey bee South and Middle Urals demonstrated their genetic differentiation and division into sub-population as a whole. There was a joint group yusvenskoy honeybee population with Burzyan, which was previously determined on the basis of genetic research as the population of Central bee Apis mellifera mellifera. This indicates the origin of the local population yusvenskoy honeybee on nuclear and mitochondrial DNA from the subspecies Ammellifera. Previously defined on the basis of genetic studies hybrid Iglinskiy local honeybee population in this study has a separate. It should be noted characteristic of the majority populations of the honey bee in the Urals small deficit of heterozygotes and inbreeding. Hybrid Iglinskiy population, by contrast, is characterized by an excess of heterozygotes and outbreeding. Thus, in the South (Burzyan district of Bashkortostan) and the Middle Urals (Yusvensky region of Komi-Perm district of the Perm region) is still preserved local populations of the honey bee subspecies Ammellifera with enough for a long time the existence of a population the size of the area and population.
  085. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Филогенетический анализ медоносной пчелы северной башкирской популяции. Материалы докладов XXIV Любищевских чтений "Современные проблемы эволюции". Ульяновск. 2010. С. 113-119.  

Нами были просеквенированы нуклеотидные последовательности фрагмента интрона гена фактора элонгации EF-1a у медоносных пчел из 3 семей с севера ареала башкирской популяции Apis mellifera mellifera (Бирский район республики Башкортостан). Как можно отметить, нуклеотидная последовательность интрона гена фактора элонгации EF-1а ядерной ДНК вариабельна среди представителей рода Apis – 105 вариабельных сайтов, что составляет более 40%. Вариабельность этого локуса среди представителей вида Apis mellifera, напротив, очень низка - 4 вариабельных сайта, что составляет около 2%. Кроме того, среди представителей пчел рода Apis наблюдается большие участки с инсерциями и делециями, которые не были использованы при подсчете уровня вариабельности, что может повысить его уровень (Табл. 1).
По результатам сравнительного анализа нуклеотидных последовательностей фрагмента интрона гена фактора элонгации EF-1a семей медоносных пчел с севера ареала башкирской популяции A.m.mellifera: 3504 Birsk Apis mellifera mellifera (Бирск, Башкортостан); 3502 Birsk Apis mellifera mellifera (Бирск, Башкортостан); 3503 Birsk Apis mellifera mellifera (Бирск, Башкортостан) с последовательностями, опубликованными в генбанке: Ay721702 Apis andreniformis, Ay721703 Apis andreniformis; Ay721704 Apis dorsata, Ay721705 Apis dorsata, Ay721706 Apis dorsata; Ay721707 Apis dorsata, Ay721708 Apis florea; Ay721709 Apis florea; Ay721710 Apis mellifera ligustica; Ay721711 Apis koschevnikovi; Ay721712 Apis koschevnikovi; Ay721713 Apis koschevnikovi, Ay721714 Apis koschevnikovi; Ay721715 Apis koschevnikovi; Ay721716 Apis mellifera lamarckii; Ay721717 Apis nuluensis (Arias, Sheppard, 2005) методом кластеризации ближайшего соседа программой MEGA 3.1 была построена дендрограмма генетических отношений разных видов рода Apis (Рис. 1).
На дендрограмме наблюдается разделение на четыре группы. Представители каждого вида преимущественно кластеризуются в отдельные группы. В первую группу вошли представители западной медоносной пчелы вида Apis mellifera, обладающие довольно низким уровнем вариабельности между подвидами. Сюда же вошли представители Apis mellifera mellifera Южного Урала. Во вторую группу вошли представители гигантских азиатских пчел вида Apis dorsata, характеризующиеся малой степенью вариабельностью между экотипами. В третью группу вошли представители азиатских пчел видов Apis koschevnikovi и Apis nuluensis. Эти два вида пчел имеют очень низкую степень генетической дифференциации между собой, тогда как некоторые экотипы Apis koschevnikovi отличаются очень сильно. В четвертую группу вошли представители азиатских карликовых пчел видов Apis andreniformis с Apis florea. Представители каждого из них располагаются в отдельных подгруппах, которые дифференцированы на относительно высоком уровне. Из всех проанализированных видов пчел рода Apis гигантские пчелы вида Apis dorsata наиболее генетически близки к западной пчеле вида Apis mellifera.
Секвенционный анализ фрагмента интрона гена фактора элонгации EF-1a, возможно, позволяет провести филогенетическую реконструкцию рода Apis, что также представлено в работе M.C.Arias, W.S.Sheppard (2005). Предполагается, что даже наблюдаемый низкий уровень дивергенции позволит получить данные о филогенетическом паттерне вида Apis mellifera при исключении из анализа представителей других видов рода Apis, на фоне высокого уровня вариабельности которых внутривидовая вариабельность Apis mellifera существенно принижается.
В дальнейшем мы попытались провести филогенетический анализ внутри вида A.mellifera. На основе сравнительного анализа нуклеотидных последовательностей фрагмента интрона гена фактора элонгации EF-1a вида A.mellifera семей с севера ареала башкирской популяции A.m.mellifera с последовательностями Ay721710 A.mellifera ligustica и Ay721716 A.mellifera lamarckii, опубликованными в генбанке, методом кластеризации ближайшего соседа программой MEGA 3.1 нами была построена дендрограмма филогенетических отношений разных подвидов Apis mellifera (Рис. 2). Представители разных подвидов на дендрограмме группируются раздельно. Это показывает возможность использования фрагмента интрона гена фактора элонгации EF-1a для решения вопросов внутривидовой филогении, несмотря на то, что между подвидами наблюдаются только 4 сайта замен (Табл. 1). Таким образом ядерный маркер - интрон гена фактора элонгации EF-1a эффективен в решении проблем систематики и филогенетики как на родовом, так и видовом уровнях. Такое свойство этого маркера можно применить к российским условиям, так как уже давно отмечается проблема массовой гибридизации подвидов медоносной пчелы из южных и северных регионов России. В частности, для республики Башкортостан существует проблема сохранения аборигенного подвида A.m.mellifera от гибридизации с привозными медоносными пчелами разных подвидов из южных регионов России и Ближнего Зарубежья. Ранее нами для идентификации подвидов медоносной пчелы использовались преимущественно маркеры митохондриальной ДНК. Дополнительное использование ядерных маркеров наряду с митохондриальными позволит пролить свет на процессы и пропорции отцовского и материнского наследования в гибридных популяциях медоносной пчелы.
We have sequenced the nucleotide sequence of a fragment of an intron of the gene elongation factor EF-1a in honey bees from three families from the north area of ​​the Bashkir population of Apis mellifera mellifera (Birsky region of the republic of Bashkortostan). As can be noted, the nucleotide sequence of intron of the elongation factor EF-1a nuclear DNA is variable among members of the genus Apis - 105 variable sites, representing more than 40%. The variability of this locus among the species Apis mellifera, on the contrary, very low - 4 variable site, which is about 2%. Furthermore, among the genus Apis bees observed large areas with insertions and deletions, which were not used in calculating the level of variability that can increase its level (Table. 1).
According to the results of the comparative analysis of the nucleotide sequences of the intron of the gene fragment elongation factor EF-1a family of honeybees from the north area of ​​the Bashkir population Ammellifera: 3504 Birsk Apis mellifera mellifera (Birsk, Bashkortostan); 3502 Birsk Apis mellifera mellifera (Birsk, Bashkortostan); 3503 Birsk Apis mellifera mellifera (Birsk, Bashkortostan) with sequences published in GenBank: Ay721702 Apis andreniformis, Ay721703 Apis andreniformis; Ay721704 Apis dorsata, Ay721705 Apis dorsata, Ay721706 Apis dorsata; Ay721707 Apis dorsata, Ay721708 Apis florea; Ay721709 Apis florea; Ay721710 Apis mellifera ligustica; Ay721711 Apis koschevnikovi; Ay721712 Apis koschevnikovi; Ay721713 Apis koschevnikovi, Ay721714 Apis koschevnikovi; Ay721715 Apis koschevnikovi; Ay721716 Apis mellifera lamarckii; Ay721717 Apis nuluensis (Arias, Sheppard, 2005) by the nearest neighbor clustering program MEGA 3.1 was constructed dendrogram genetic relationships of different species of the genus Apis (Fig. 1).
In the observed dendrogram divided into four groups. Representatives of each species predominantly clustered into individual groups. The first group included representatives of the western honey bee species Apis mellifera, have relatively low variability between subspecies. This also includes representatives of Apis mellifera mellifera Southern Urals. The second group included representatives of the giant Asian bee species Apis dorsata, characterized by a low degree of variability among ecotypes. The third group included representatives from the Asian bee species Apis koschevnikovi and Apis nuluensis. These two types of bees have a very low degree of genetic differentiation between them, while some ecotypes of Apis koschevnikovi differ greatly. The fourth group includes representatives of Asian dwarf bee species Apis andreniformis with Apis florea. Representatives of each of them are located in separate groups which are differentiated to a relatively high level. Of all the analyzed species of the genus Apis bees giant bee species Apis dorsata most genetically close to the western bee species Apis mellifera.
Sekventsionny analysis fragment intron of the elongation factor EF-1a, may allows for phylogenetic reconstruction of the genus Apis, which is also represented in the MCArias, WSSheppard (2005). It is expected that even low levels of divergence observed will provide data on the phylogenetic pattern of species Apis mellifera to the exclusion from the analysis of other species of the genus Apis, coupled with a high level of variability that intraspecific variability of Apis mellifera significantly belittled.
In the future, we tried to carry out phylogenetic analysis within the species A.mellifera. On the basis of a comparative analysis of the nucleotide sequences of the intron of the gene fragment elongation factor EF-1a species A.mellifera families from the north area of ​​the Bashkir population Ammellifera sequences Ay721710 A.mellifera ligustica and Ay721716 A.mellifera lamarckii, published in GenBank, the nearest neighbor clustering method MEGA program 3.1 we constructed a dendrogram of phylogenetic relationships of different subspecies Apis mellifera (Fig. 2). Representatives of different subspecies in the dendrogram grouped separately. This shows the possibility of using a gene intron fragment elongation factor EF-1a to address intraspecific phylogeny, despite the fact that between the subspecies observed only substituting 4 sites (Tab. 1). Thus the nuclear marker - intron gene elongation factor EF-1a is effective in solving problems of systematics and phylogenetics as generic and species levels. This property of this marker can be applied to Russian conditions, as has long been noted the problem of mass hybridization honeybee subspecies of the southern and northern regions of Russia. In particular, for the Republic of Bashkortostan there is the problem of preservation of aboriginal subspecies Ammellifera by hybridization with imported honeybees of different subspecies of the southern regions of Russia and abroad. Earlier we have to identify subspecies of honeybee mainly used mitochondrial DNA markers. The additional use of nuclear markers along with mitochondrial will shed light on the processes and proportions of paternal and maternal inheritance in hybrid populations of the honey bee.
  084. Николенко А.Г., Ильясов Р.А., Поскряков А.В. Информативность полиморфизма мт-ДНК медоносной пчелы Apis mellifera L. (Hymenoptera: Apidae) в популяционно-генетических исследованиях. Материалы II Симпозиума стран СНГ по перепончатокрылым насекомым. Санкт-Петербург. 2010. С. 106.  

Зональные перемещения пчел, скрещивание разных подвидов в про граммах улучшения и размножения привели к потере некоторых полезных свойств генофонда. За последние 60-70 лет во многих регионах России и странах Западной Европы произошла (и происходит) массовая гибридизация пчел, что привело к необратимым процессам, препятствующим восстановлению исходного местного генофонда. В результате сильно пострадала среднерусская пчела, которая практически исчезла в некоторых местах ее традиционного разведения (Черевко, 2005; Кривцов, 2000,2008). Тем не менее в России еще сохранились резервы генофонда А т. mellifera L., которые можно использовать для восстановления популяции на границах его естественного ареала (Билаш, 1991; Лебедев, Билаш, 1991; Кривцов, 2005). Одной из наиболее известных популяций темной лесной пчелы является башкирская, фактические данные о состоянии генофонда которой публиковались в последнее десятилетие лишь несколькими авторами. В 2000 г. на основе анализа полиморфизма межгенного локуса COICOII мтДНК и морфометрических данных на территории Башкортостана показано существование лишь одной сохранившейся аборигенной бурзян- ской популяции А. т. mellifera (Саттаров, Николенко, 2000; Николенко, Поскряков, 2002). В дальнейшем поиск сохранившихся резерватов генофонда этого подвида был продолжен, и на севере республики (Татышлин ский район) была обнаружена еще одна локальная популяция А. гп. те lifera (Ильясов и др., 2006). Мы предположили, что ареал северной попу ляции А. т. mellifera республики может быть шире (Шареева и др., ^ Для сохранения генофонда ценного подвида А. т. mellifera как в ^ сии, так и в Республике Башкортостан, необходимо иметь несколько г ^ тических резерватов, располагать информацией об их поп^ЛЯЦИ1°ьНЫХ генетической структуре и границах ареалов составляющих его лок популяций (Николенко, Поскряков, 2002). Zonal movement of bees, crossing different subspecies in the pro grams improvement and propagation led to some loss of useful the properties of the gene pool. Over the past 60-70 years in many regions of Russia and Western Europe there was (and is happening) mass hybridisation bees, leading to irreversible processes, hindering recovery source of local gene pool. As a result, severely damaged Central Russian bee, which has virtually disappeared in some places its traditional breeding (Cherevko, 2005; Krivtsov, 2000.2008). Nevertheless, the Russian Federation remains of the gene pool reserves A m. Mellifera L., which can be used to restore the population in the the limits of its natural range (Bilash, 1991; Lebedev, Bilash, 1991; Krivtsov, 2005). One of the most known populations of the dark forest Bashkir bee is, the actual data on the state of the gene pool which were published in the last decade, only a few authors. In 2000, based on the analysis of polymorphism of the intergenic locus COICOII mtDNA and morphometric data in Bashkortostan It demonstrated the existence of only one surviving aboriginal burzyan- tion of the population of A. m. mellifera (Sattar, Nikolenko, 2000; Nikolenko, Poskryakov, 2002). In the future, search for the remaining reserves of the gene pool this subspecies was continued, and in the north of the country (Tatyshlin sky district) was discovered another local population of A. r. those lifera (Ilyasov et al., 2006). We assumed that the area of the northern ass tion A. m. mellifera republic may be wider (Shareeva et al., ^ To preserve the gene pool of valuable subspecies A. m. Mellifera in ^ these, as well as in the Republic of Bashkortostan, it is necessary to have some r cal reserves, to have information about their pop LYATSI1 ° ^ NYH genetic structure and boundaries of areas of its component Locos populations (Nikolenko, Poskryakov, 2002). 
  083. Фахретдинова С.А., Ильясов Р.А., Поскряков А.В., Николенко А.Г. Определение границ бурзянской популяции медоносной пчелы Apis mellifera mellifera L. Материалы третьей международной научно-практической конференции "Актуальные вопросы энтомологии". Ставрополь. 2010. С. 154-155.  

На Урале известно несколько сохранившихся популя - mellifera mellifera L. В Башкирии это северная и южная (Т ^ ская) популяции. Уникальность бурзянской популяции заюткГ^' ся в высокой степени естественной изоляции, вследствие чего^' пуляция меньше подвержена гибридизации. Кроме того, этоо™ из наиболее интактных популяций тёмной лесной пчелы среди™ хранившихся в наши дни. Бурзянская популяция характеризуется также наличием большого числа бортевых семей. Для решения проблемы сохранения генофонда как бортевых пчел, так и популяции в целом важно знать генетические процессы происходящие внутри и в краевых зонах популяции. Кроме того, бортевые пчелы не обладают минимальной численностью для сохранения генофонда и нуждаются в постоянном его пополнении за счет пасечных пчел. Анализ полиморфизма митохондриального (межгенный локус С 0 1 - С 0 П ) и ядерного (локусы ар243, 4а 110, ар049 и а24) геномов показал, что бурзянская популяция сохранилась практически чистопородной. Небольшая степень гибридизации, обнаруженная нами на территории заповедника Шульган-Таш, ничтожнамала. Такой умеренный, на наш взгляд, приток генов не д о лж е н вы вать серьезных нарушений в генофонде с у б п о п у л я ц и и . ^ Определилась часть границ ареала бурзянской подул ^ верные (Белорецкий р-н), восточные (Абзелиловскии Р восточные (Баймакский р-н) и западные (КугаРчинс* ^ ареала зовский и Ишимбайский р-ны). Такие очертания ^гр^ ге0Гр3фи- объясняются, прежде всего, естественными ФаКр ° ^ яНСКий Ра1*оН ческим положением и растительным покровом. УР ^ й длатаУ’ расположен в долине между двумя хребтами. Р ^ оЛЯЦЙи и сП\ что обеспечивает высокую степень е с т е с т в е н н о й ^ ^ стороН^ жит естественным барьером на пути потока ге районов н, „ет н а с ел ен ны х пунктов, что тоже способствуе т е километры » твеНной границей ареала. Восточную Гизоляиии и служи у тау> обесПечивает также природная 1яиЦУ- кРоМепес^ в „ практически полное отсутствие медоносов, зона ‘осНОВ“ 1 и из Зилаирского района показал, что бу рзянская диализ вьГО°РК‘паНИЧивается пределами Бурзянского района, „опуляиия не 01 р часть границы ареала бурзянской популяции установлено> енно п0 границе с Кугарчинским районом, проходит неп и показала принадлежность этих пчел к кавказ- выборка из к п '|б р н д и з о в а н нЫ е пчелиные семьи могут находить- СК0'Непосредственной близости к заповеднику Шульган-Таш в его юго-западной части. In the Urals there are several surviving popula- - mellifera mellifera L. In Bashkortostan is the northern and southern (T ^ Skye) population. The uniqueness of the population Burzyan zayutkG ^ ' Xia highly natural insulation, whereby ^ ' populations less susceptible to hybridization. In addition, Eto'o ™ of the most intact populations of bees among the dark forest ™ kept today. Burzyan population characterized as the presence of a large number of family tree hollow. To solve the problem of preservation of the gene pool as a tree hollow bees and the general population, it is important to know the genetic processes occurring both inside and in the marginal areas of the population. Moreover, wild-hive the bees do not have the minimum number to save genetic resources and need constant replenishment of its by beekeeping bees. Analysis of mitochondrial polymorphism (intergenic locus C 0 1 - P P 0) and nuclear (loci ar243, 4a 110 ar049 and A24) genomes It showed that the population remained virtually Burzyan thoroughbred. A small degree of hybridization detected us on the reserve Shul'gan-Tash nichtozhnamala. Such moderate, in our opinion, the influx of genes of the left ventricle is not d e n you Vat serious violations in the gene pool with y b n o p y l i i and u. ^ Define the boundaries of the area Burzyan blew ^ right (Beloretsk district), eastern (P Abzelilovsky Eastern (Baimaksky district) and western (* ^ KugaRchins area zovsky Ishimbay and districts). These outlines ^ c ^ ge0Gr3fi- explained primarily by natural faqr ° ^ Jansky PA1 * oH cal position and vegetation. UR ^ th dlataU ' Located in a valley between two mountain ranges. Pj oLYaTsYi and SP \ which provides a high degree of e s t e s t e n n in a second side of the ^ ^ ^ tains a natural barrier to the flow areas n n, "a district and ate with us en pips, which is also contributing to the te kilometers "Twain border area. East Gizolyaiii and served with tau> also provides a natural 1yaiTsU- kRoMepes ^ in "almost complete absence of honey plants, Zone 'of "1 and from Zilair district showed that boo rzyanskaya Dialysis vGO ° RK'paNIChivaetsya outside Burzyansky area "01 p opulyaiiya not part of the border area population Burzyan set> enno n0 Kugarchinskim border area, ting passes and showed those belonging to the Caucasian bees a sample of n '| b n d p and s to us in a n e bee colonies can be situated SK0'Neposredstvennoy proximity to the reserve Shulgan-Tash in his south-western part. 

  082. Салтыкова Е.С., Ильясов Р.А., Гайфуллина Л.Р., Поскряков А.В., Ямиданов Р.С., Николенко А.Г. Экспрессия антимикробных пептидов абецина и дефензина в организме медоносной пчелы Apis mellifera mellifera. Материалы третьей международной научно-практической конференции "Актуальные вопросы энтомологии". Ставрополь. 2010. С. 85.  

Антимикробные пептиды (АМП) в организме медоносной пчелы играют важную роль в иммунитете и выживаемости. Два наиболее известных из них дефензин и абецин. Нами был проведен ПЦР в режиме реального времени по результатам поставленного эксперимента при однократном кормлении пчел 0,001% раствором хитозана. После кормления пчел экстрагировалась мРНК, на основе которой синтезировалась кДНК для последующей ПЦР в режиме реального времени (ПЦР РВ). Целью нашего эксперимента стала проверка влияния хитозана на уровень экспрессии антимикробных пептидов абецина и дефензина у медоносной пчелы. Ген MGST в эксперименте использовался в качестве контроля, как ген, на экспрессию которого не должно влиять кормление хитозаном.
Нами были получены данные об уровне изменения экспрессии каждого антимикробного пептида в отдельности в двух повторностях. По результатам поставленных экспериментов после кормления пчел хитозаном можно заключить, что уровень экспрессии дефензина имеет тенденцию к увеличению на 142% (P=0,053) в 1 эксперименте и на 96% (P=0,033) во 2 эксперименте. Уровень экспрессии абецина увеличился на 188% (P<0,001) в 1 эксперименте и на 100% (P<0,001) во 2 эксперименте.
Таким образом, можно предположить, что однократное кормления пчел 0,001% раствором хитозана приводит к заметному увеличению уровня экспрессии антимикробных пептидов дефензина (в 2-2,8 раз) и абецина (в 1,9-2,4 раза) в организме медоносной пчелы Apis mellifera mellifera.
Antimicrobial peptides (AMPs) in the body of the honeybee play an important role in immunity and survival. The two most prominent of these defensin and abetsin. We carried out the PCR in real time from the results of the experiment with a single staged feeding of bees 0.001% solution of chitosan. After feeding, the bees extracted mRNA from which the cDNA was synthesized for subsequent PCR in real time (real-time PCR). The purpose of our experiment was to check the effect of chitosan on the level of expression of antimicrobial peptides and abetsina defensin in the honeybee. MGST gene used in the experiment as a control as the gene for expression of which should not affect feeding chitosan.
We obtained data on the changes in the expression level of each of the antimicrobial peptide separately in duplicate. According to the results of experiments set after feeding bees chitosan it can be concluded that the expression level of defensin tends to increase by 142% (P = 0,053) in one experiment and by 96% (P = 0,033) in the two experiments. The expression level of abetsina increased by 188% (P <0,001) in experiment 1 and 100% (P <0,001) in the 2nd experiment.
Thus, it can be assumed that a single foraging bees 0.001% chitosan solution leads to a marked increase in the level of expression of defensin antimicrobial peptides (in 2-2,8 times) abetsina (a 1.9-2.4-fold) in the body of the honeybee Apis mellifera mellifera.
  081. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Генное разнообразие и коэффициенты инбридинга медоносной пчелы в локальной популяции на севере Республики Башкортостан. Материалы III всероссийской научно-практической конференции "Полевые и экспериментальные исследования биологических систем". Ишим. 2010. С. 66-68.  

Естественный ареал Apis mellifera L. охватывает всю Африку, Европу и Ближний Восток. Отличительная черта вида – значительная внутривидовая дифференциация (Ruttner, 1988). По современной классификации (Engel, 1999) вид подразделен на 25 подвидов.  За последние 60-70 лет во многих регионах России и странах Западной Европы произошла массовая гибридизация пчел, что привело к необратимым процессам, препятствующим восстановлению исходного местного генофонда. В результате сильно пострадала среднерусская пчела, которая практически исчезла в некоторых местах ее традиционного разведения (Черевко, 2005; Кривцов, 2000, 2008).
В России еще сохранились резервы генофонда A.m.mellifera, которые можно использовать для восстановления популяции на границах его естественного ареала (Билаш, 1991; Лебедев, Билаш, 1991; Кривцов, 2005). Одной из наиболее известных популяций темной лесной пчелы является башкирская, фактические данные о состоянии генофонда которой публиковались в последнее десятилетие лишь несколькими авторами. В 2000 году на основе анализа полиморфизма межгенного локуса COI-COII мтДНК и морфометрических данных на территории Республики Башкортостан было показано существование лишь одной сохранившейся аборигенной бурзянской популяции A.m.mellifera (Саттаров, Николенко, 2000; Николенко, Поскряков, 2002). В дальнейшем поиск сохранившихся резерватов генофонда этого подвида был продолжен, и на севере республики была обнаружена еще одна локальная популяция A. m. mellifera в Татышлинском районе Республики Башкортостан (Ильясов с соавт., 2006). Для сохранения генофонда ценного подвида A.m.mellifera как в России, так и в Республике Башкортостан, необходимо иметь несколько генетических резерватов, располагать информацией об их популяционно-генетической структуре и границах ареалов составляющих его локальных популяций (Николенко, Поскряков, 2002). Целью исследований было изучение структуры популяции медоносной пчелы северного ареала Республики Башкортостан.
Нами были изучены пчелы с 42 пасек трех северных районов (Бирский, Караидельский, Мишкинский). Всего было проанализировано по микросателлитным локусам ар243, 4а110 и А8 ядерной ДНК пчел из 211 семей исследуемых районов Республики Башкортостан. В изучаемой выборке пчел нами были рассчитаны F-коэффициенты и гетерозиготность. Использование в анализе F-коэффициентов и гетерозиготностей позволяет наиболее полноценно и всесторонне охарактеризовать популяции и сравнивать их с аналогичными показателями других популяций. Кроме того, эти характеристики позволяют говорить о процессах, происходящих в популяции и прогнозировать дальнейшую динамику популяции. Анализ средних значений последних по микросателлитным локусам ap243, 4a110 и А8 ядерной ДНК (Табл. 1) показал, что популяция северного ареала башкирской пчелы характеризуется низким уровнем генетической дифференциации (FST=0,015) между субпопуляциями, что свидетельствует о возможном единстве происхождения пчел из этих популяций.
Близкие к нулю значения коэффициентов инбридинга (FIS=0,122 и FIT=0,135) и близкие значения наблюдаемой (HО=0,435) и ожидаемых (HS=0,485 и HТ=0,493) показателей гетерозиготности отражают баланс между инбридингом и аутбридингом, как в отдельных субпопуляциях, так и во всей популяции, в целом, а также свидетельствуют о том, что распределение генотипов по всем локусам приближается к равновесному по Харди-Вайнбергу. Такое равновесное состояние дает возможность длительного существования популяции в современных неизменных условиях окружающей среды.
Таблица 1
F-коэффициенты и гетерозиготность популяции северной ареала башкирской пчелы A.m.mellifera
FST*    FIS    FIT    HО    HS    HТ
0,015    0,122    0,135    0,435    0,485    0,493
* FST - средний уровень генетической дифференциации между субпопуляциями; FIS – средний уровень инбридинга и отклонение от пропорций Харди-Вайнберга внутри субпопуляций; FIT – средний уровень инбридинга и отклонение от пропорций Харди-Вайнберга во всей популяции; HT - средняя ожидаемая гетерозиготность во всей популяции между локусами; HO – средняя наблюдаемая гетерозиготность внутри субпопуляций между локусами; Hs – средняя ожидаемая гетерозиготность внутри субпопуляций между локусами.

Таким образом, популяция северного ареала башкирской пчелы A.m.mellifera характеризуется отсутствием подразделенности между населениями пчел Бирского, Караидельского и Мишкинского районов. Минимальное отклонение от равновесия Харди-Вайнберга свидетельствует об устойчивости популяции во времени и незначительном влиянии на нее факторов эволюции. Наблюдаемые коэффициенты инбридинга в популяции можно принять за оптимальные равновесные значения, которые сложились в течение продолжительного времени становления северной популяции A.m.mellifera, которые можно использовать в сравнении с другими популяциями.
The natural habitat of Apis mellifera L. covers the whole of Africa, Europe and the Middle East. A distinctive feature of the form - a significant intraspecific differentiation (Ruttner, 1988). According to modern classification (Engel, 1999) view is divided into 25 sub-species. Over the past 60-70 years in many regions of Russia and countries of Western Europe there was a mass of bees hybridization, leading to irreversible processes, prevent recovery of the original local gene pool. As a result, I suffered greatly Central Russian bee, which has virtually disappeared in some areas of its traditional breeding (Cherevko, 2005; Krivtsov, 2000, 2008).
The Russian Federation remains of the gene pool reserves Ammellifera, which can be used to restore the population on the borders of its native range (Bilash, 1991; Lebedev, Bilash, 1991; Krivtsov, 2005). One of the most famous dark forest bee populations is Bashkir, evidence on the state of the gene pool which is published in the last decade, only a few authors. In 2000, based on the analysis of polymorphism of the intergenic locus COI-COII mtDNA and morphometric data on the territory of the Republic of Bashkortostan has been shown the existence of only one surviving indigenous populations Burzyan Ammellifera (Sattar, Nikolenko, 2000; Nikolenko, Poskryakov, 2002). In the future, search for the remaining reserves of the gene pool of this subspecies was continued, and in the north of the country has found another local population of A. m. mellifera in Tatyshlinskom area Bashkortostan (Ilyasov et al., 2006). To preserve the gene pool of valuable subspecies Ammellifera both in Russia and in the Republic of Bashkortostan, it is necessary to have some genetic reserves, to have information about their population-genetic structure and the boundaries of the ranges of its constituent local populations (Nikolenko, Poskryakov, 2002). The aim was to study the structure of the honey bee population of the northern area of ​​the Republic of Bashkortostan.
We have studied bees with 42 apiaries three northern regions (Birsky, Karaidelsky, Mishkinskoye). There were analyzed for microsatellite loci ar243, 4a110 and A8 nuclear DNA of 211 families of bees studied areas of the Republic of Bashkortostan. In our sample of bees we calculated F-ratios and heterozygosity. Using the analysis of F-ratios and heterozygous allows most fully and comprehensively characterize the population, and to compare them with those of other populations. In addition, these characteristics allow us to speak about the processes occurring in the population and to predict the future dynamics of the population. Analysis of the average of the last of microsatellite loci ap243, 4a110 A8 and nuclear DNA (Table. 1) showed that the population of the northern area of ​​the Bashkir bee is characterized by a low level of genetic differentiation (FST = 0,015) between subpopulations, suggesting a possible common origin of these populations of bees .
Near-zero coefficient of inbreeding (FIS = 0,122 and FIT = 0,135) and similar values ​​observed (HO = 0.435) and expected (HS = 0,485 and HT = 0.493) heterozygosity indices reflect a balance between inbreeding and outbreeding, in certain subpopulations, as and in the population as a whole, as well as evidence that the distribution of genotypes at all loci close to the equilibrium of Hardy-Weinberg equilibrium. This equilibrium state allows continued existence of the population in modern constant environmental conditions.
Table 1
F-ratios and heterozygosity of the population of northern area of ​​the Bashkir bee Ammellifera
FST * FIS FIT BUT HS HT
0.015 0.122 0.135 0.435 0.485 0.493
* FST - the average level of genetic differentiation between subpopulations; FIS - average level of inbreeding and deviation from Hardy-Weinberg proportions within subpopulations; FIT - the average level of inbreeding and deviation from Hardy-Weinberg proportions in the general population; HT - average expected heterozygosity in the total population between loci; HO - average observed heterozygosity in subpopulations between loci; Hs - the average expected heterozygosity in subpopulations between loci.

Thus, the population of the northern area of ​​the Bashkir bee Ammellifera characterized by lack of division between the population of bees Birsk, Karaidelskogo and Mishkinsky areas. Minimum deviation from Hardy-Weinberg equilibrium demonstrates the stability of the population in time and insignificant effect on her evolutionary factors. The observed rates of inbreeding in the population can be taken for optimal equilibrium values ​​that have been established for a long time the formation of northern populations Ammellifera, which can be used in comparison with other populations.
  080. Салтыкова Е.С., Ильясов Р.А., Гайфуллина Л.Р., Поскряков А.В., Ямиданов Р.С., Николенко А.Г. Изменение уровня экспрессии антимикробных пептидов в организме медоносной пчелы Apis mellifera mellifera L. Материалы международнародной научно-практической конференции "Современное пчеловодство. Проблемы, опыт, новые технологии". Ярославль. 2010. С. 159-160.  

Антимикробные пептиды (АМП) в организме медоносной пчелы играют важную роль в иммунитете и выживаемости. Два наиболее известных из них дефензин и абецин. Нами был проведен ПЦР в режиме реального времени по результатам поставленного эксперимента при однократном кормлении пчел 0,001% раствором хитозана. После кормления пчел экстрагировалась мРНК, на основе которой синтезировалась кДНК для последующей ПЦР в режиме реального времени (ПЦР РВ). Целью нашего эксперимента стала проверка влияния хитозана на уровень экспрессии антимикробных пептидов абецина и дефензина у медоносной пчелы. Ген MGST в эксперименте использовался в качестве контроля, как ген, на экспрессию которого не должно влиять кормление хитозаном.
Нами были получены данные об уровне изменения экспрессии каждого антимикробного пептида в отдельности в двух повторностях. По результатам поставленных экспериментов после кормления пчел хитозаном можно заключить, что уровень экспрессии дефензина имеет тенденцию к увеличению на 142% (P=0,053) в 1 эксперименте и на 96% (P=0,033) во 2 эксперименте. Уровень экспрессии абецина увеличился на 188% (P<0,001) в 1 эксперименте и на 100% (P<0,001) во 2 эксперименте (Таб. 1), (Рис. 1).
Таким образом, можно предположить, что однократное кормления пчел 0,001% раствором хитозана приводит к заметному увеличению уровня экспрессии антимикробных пептидов дефензина (в 2-2,8 раз) и абецина (в 1,9-2,4 раза) в организме медоносной пчелы Apis mellifera mellifera.
Antimicrobial peptides (AMPs) in the body of the honeybee play an important role in immunity and survival. The two most prominent of these defensin and abetsin. We carried out the PCR in real time from the results of the experiment with a single staged feeding of bees 0.001% solution of chitosan. After feeding, the bees extracted mRNA from which the cDNA was synthesized for subsequent PCR in real time (real-time PCR). The purpose of our experiment was to check the effect of chitosan on the level of expression of antimicrobial peptides and abetsina defensin in the honeybee. MGST gene used in the experiment as a control as the gene for expression of which should not affect feeding chitosan.
We obtained data on the changes in the expression level of each of the antimicrobial peptide separately in duplicate. According to the results of experiments set after feeding bees chitosan it can be concluded that the expression level of defensin tends to increase by 142% (P = 0,053) in one experiment and by 96% (P = 0,033) in the two experiments. The expression level of abetsina increased by 188% (P <0,001) in experiment 1 and 100% (P <0,001) in experiment 2 (Table. 1) (Fig. 1).
Thus, it can be assumed that a single foraging bees 0.001% chitosan solution leads to a marked increase in the level of expression of defensin antimicrobial peptides (in 2-2,8 times) abetsina (a 1.9-2.4-fold) in the body of the honeybee Apis mellifera mellifera.
  079. Колбина Л.М., Непейвода С.Н., Масленников И.В., Воробьева С.Л., Ильясов Р.А., Поскряков А.В., Николенко А.Г. Генетический и морфологический анализ породности пчелиных семей шарканского и завьяловского районов удмуртской республики. Материалы международнародной научно-практической конференции "Современное пчеловодство. Проблемы, опыт, новые технологии". Ярославль. 2010. С. 71-73.  

На сегодняшний день существует две основные методики определения породной принадлежности пчел, ни одну из которых не стоит
абсолютизировать. Молекулярно-генетическая методика позволяет
оценить происхождение пчелиных семей независимо от их морфологических признаков и часто позволяет ныинить гибридов в тех случаях, когда методика оценки жетерьера дает сбои. Но, несмотря на все дос шине 1 на молекулярно-генетической методики у нее есть и cvuKCTHCHHbiii недостаток. Поскольку аборигенными пчелами для нсего 11оно.1ЖЬЯ, н том числе и Удмуртии были среднерусские пчелы, то есть пчелы Apis mellifera mellifera L., а завезенные семьи южных пород составляли небольшой процент от общего количества разводимых пчел. Это привело к тому, что большая часть гибридизации местных пчел произошла по мужской линии, которую использованная молекулярно-генетическая методика, к сожалению, учесть не может, С другой стороны большая вариабельность морфологических признаков, появившаяся в результате гибридизации, привела к тому, что часть помесных пчел может по экстерьеру соответствовать среднерусской породе, ей по сути не являясь. Поэтому достоверные результаты могут быть получены только при использовании как морфологических, так и молекулярно-генетических методов исследования.
Нами были проанализированы пчелиные семьи из двух районов Шарканского (2 пасеки - 15 семей из села Нижнее Корякино и 19 из Шаркана) и Завьяловского (3 пасеки - 19 семей из села Люк, 15 - Постол и 5 - из деревни Макарово). Был проведен сравнительный популяционно-генетический анализ пчелиных семей этих двух районов, а также сравнительный анализ отдельно по пасекам на основе изучения межгенного локуса COI-COII мтДНК.
Исследования по генетическому анализу проводилась совместно с РА. Ильясовым, А.Г. Николенко из института биохимии и генетики Уфимского научного центра РАН. Основу генетического анализа составил установленный ранее полиморфизм межгенного локуса COI-COII у представителей разных подвидов A.mellifera. Установлено, что протяженный АТ-богатый межгенный участок мтДНК. локализованный между генами COI и СОИ. не кодирующий аминокислотной последовательности, может быть использован в качестве маркера для различения подвидов A.m.mellifera и A.m.caucasica благодаря вариабельности длины, обусловленной различным соотношением элементов Р и Q, где межгенный участок у представителей ветви М (A.m.mellifera), аборигенных для республики, имеет комбинацию PQQ, тогда как у представителей ветви С (A.m.caucasica, A.m.camica. A.m.ligustica), гибридизация с которыми наблюдается на территории республики, имеется единственный элемент Q. Таким образом, межгепный локус СО [-СО II мтДНК у представителей эволюционной ветви С и их гибридов по материнской линии на 268 п.н. короче межгенного локуса COI-COII мтДНК у представителей ветви М, и эти локусы легко разделяются при электрофорезе. Размер продукта ПЦР межгенного локуса COI-COII мтДНК, включающий и ген тРНКЬеи у представителей A.m.mellifera, равен примерно 600 п.н., а у представителей эволюционной ветви С и их гибридов по материнской линии - 350 п.н. Этот маркер был использован нами для поиска популяций A.m.mellifera.
Для сравнительного анализа была использована методика оценки экстерьера согласно рекомендациям всероссийского научноисследовательского института пчеловодства.
При изучении межгенного локуса COI-COII митохондриальной ДНК, при анализе по двум районам (табл.1.) заметно, что встречаемость строения межгенного локуса Q больше чем в два раза выше в завьяловский популяции, что говорит о происхождении 38,5% пчелиных семей завьяловской популяции по материнской линии от пчел южных пород. Кроме этого следует отметить наличие в Шарканской популяции аномального строения межгенного локуса С01-С0П митохондриальной ДНК PQ. Обнаруженные различия между этими двумя популяциями достоверны (Р<0,05).
В результате ни одна из исследованных популяций не может быть отнесена к среднерусской породе пчел. При этом две популяции - люкская и макаровская, по материнской линии происходят по данным анализа митохондриальной ДНК предположительно происходят от Apis mellifera mellifera. однако сильно гибридизорованы по отцовской линии. В это же время, несмотря на неоднородное происхождение, шарканская популяция сохранила больше признаков аборигенной среднерусской породы. Корякннская популяция при совместном рассмот рении генетических и морфологических данных ближе всех остальных к абориилшой популяции среднерусских пчел.
Today, there are two basic methods for determining the breed of bees, none of which is not necessary
absolute. Molecular genetic technique allows
to assess the origin of bee families, regardless of their morphological characters and often allows nyinit hybrids in cases where assessment methodology zheterera faltering. But, despite all the dos bus 1 at the molecular and genetic techniques, and it has cvuKCTHCHHbiii disadvantage. As for native bees nsego 11ono.1ZhYa, including Mr. and Udmurtia were Central Russian bees, ie bee Apis mellifera mellifera L., and imported breeds of southern families represent a small percentage of the total farmed bees. This led to the fact that most of the hybridization of native bees occurred in the male line, which used molecular genetic techniques, unfortunately, can not be taken into account, on the other hand a large variability in morphological characters, which appeared as a result of hybridization has led to the fact that part of the hybrid Bees can match the exterior of the Central Russian breed, it is essentially not being. Therefore, accurate results can be obtained only when using both morphological and molecular genetic methods.
We analyzed bee families of the two areas Sharkansky (2 apiaries - 15 families from the village of Lower Koryakina and 19 of shuffling) and Zavyalovsky (3 apiaries - 19 families from the village of Luc, 15 - Postol and 5 - from the village Makarovo). A comparative population-genetic analysis of colonies of these two areas, as well as a comparative analysis separately for apiaries based on the study of intergenic locus COI-COII mtDNA.
Studies on the genetic analysis was conducted in conjunction with RA. Ilyasov, AG Nikolenko from the Institute of Biochemistry and Genetics, Ufa Scientific Center, Russian Academy of Sciences. The basis of genetic analysis was installed earlier polymorphism intergenic locus COI-COII representatives of different subspecies A.mellifera. It was found that the extended AT-rich intergenic site mtDNA. localized between genes COI and soybeans. does not encode an amino acid sequence it can be used as a marker to distinguish between subspecies Ammellifera and variability thanks Amcaucasica length due to various elements of the relationship of P and Q, where the representatives of intergenic site branches of M (Ammellifera), native to the country, is a combination of PQQ whereas the representatives of branches with (Amcaucasica, Amcamica. Amligustica), hybridization with whom there is in the country, there is a unique element Q. So mezhgepny locus CO [-CO II mtDNA from representatives of evolutionary branches with their hybrids maternal 268 bp short intergenic locus COI-COII mtDNA from representatives of branches of M and these loci are easily separated by electrophoresis. The size of the PCR product intergenic locus COI-COII mtDNA gene and comprising the representatives tRNKei Ammellifera, is about 600 bp, and the representatives of the evolutionary branches with their hybrids and the maternal line - 350 bp This marker was used to search for our populations Ammellifera.
For a comparative analysis was used according to the method of estimating exterior All-Russian scientific and research institute of the recommendations of the bee.
In the study of intergenic locus COI-COII mitochondrial DNA, the analysis of the two areas (Table 1). Evident that the incidence structure intergenic locus Q more than twice as high in Zavyalovsky population that speaks of the origin of 38.5% of bee colonies Zavyalovsky Population maternal bees southern rock. In addition, it should be noted the presence of an abnormal population structure Sharkan intergenic locus C01-S0P mitochondrial DNA PQ. The differences between these two populations were significant (P <0.05).
As a result, none of the studied populations can not be attributed to the Central Russian breed of bees. At the same time two populations - lyukskaya and Makarovskaya, maternal occur according to the analysis of mitochondrial DNA presumably come from Apis mellifera mellifera. however much gibridizorovany paternal. At the same time, despite the origin of the non-uniform, Sharkan population kept growing signs native of Central Russian breed. Koryaknnskaya population is under the joint rhenium Consider genetic and morphological data closer to the rest of the population aboriilshoy Central Russian bees.
  078. Fakhretdinova S.A., Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Granice zasiegu populacji pszczol miodnych Burzyan gatunku Apis mellifera mellifera L. Materials of international conference "XLVII Naukowa konferencja pszczelarska". Pulawy. 2010. P. 56.  

Na Uralu wyst^puje kilka populacji Apis mellifera mellifera L. W Baszkirii najbardziej znana to populacja Burzyan. Jest to jedna z najbardziej bliskich naturze, zyj^cych w stanie dzikim pszczola. Pszczoly Burzyan charakteryzuj^ si^ glownie tym, iz gniazda swoje buduj^ w dziuplach drzew. W celu zachowania puli genowej populacji pszczol Burzyan powinno okreslic si^ dokladnie granice zasi^gu ich wyst^powania. W tym celu, przyst^pilismy do zbierania danych dotycz^cych wyst^powania tej pszczoly w powiecie Burzyan. Dokonano analizy polimorfizmu mitochondrialnego (locus intergenic COI-COII) i j^drowego (loci ap243, 4a110, ap049 i a24) w genomie ww populacji . Wyniki wskazuj^ na utrzymywanie si^ populacji w calej badanej strefie. Okreslono granice zasi^gu populacji Burzyan: polnocna (Beloretsky), wschodnia (Abzelilovsky), poludniowo-wschodnia (Baymaksky) i zachodnia (Kugarchinsky, Meleuzovsky i Ishimbaysky). Mozna to wyjasnic korzystnymi warunkami naturalnymi: polozenie geograficznym, jak i wyst^powaniem specyficznej roslinnosci. Powiat Burzyan jest bowiem polozony w dolinie mi^dzy dwoma pasmami gorskimi: Ural-Tau i Alatau. Stanowi to zatem naturaln^ barier^ dla swobodnego przeplywu genow. W granicach administracyjnych Ishimbaysky, Meleuzovsky na przestrzeni wielu kilometrow kwadratowych znajduj^ si^ tereny nie zamieszkale, co przyczynia si^ takze do utrwalenia izolacji i utrzymania granic zasiogu wyst^powania pszczol Burzyan. Po wschodniej stronie granicy kraju wyst^puje glownie obszar lasow sosnowych, co w znacznym stopniu ulatwia zachowanie czystosci genetycznej omawianej populacji.
  077. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Comparative sequencing analysis intron of elongation factor ef1-alpha of honeybees from Russian Ural. Materials of international conference "XLVII Naukowa konferencja pszczelarska". Pulawy. 2010. P. 57.  

Comparative sequencing analysis of variability (>40 per cent) intron of elongation factor gene EF1-alpha of nuclear DNA can be used in phylogenetic reconstruction genus Apis. In this work we have for the first time shown possibility using this marker in phylogenetic reconstruction in Apis mellifera species, in spite of its low intraspecific variability (<2 per cent).
We were made sequencing analysis fragment intron of elongation factor gene EF1-alpha of honey bees from 3 colonies of a northern area of Bashkir population honeybees Apis mellifera mellifera (Russia, Birsky region of Bashkortostan republic). Comparative analysis was made with published in genebank sequences: Apis andreniformis (Ay721702, Ay721703, Ay721704), Apis dorsata (Ay721705, Ay721706, Ay721707), Apis florea (Ay721708, Ay721709), Apis mellifera ligustica (Ay721710), Apis koschevnikovi (Ay721711, Ay721712, Ay721713, Ay721714, Ay721715); Apis mellifera lamarckii (Ay721716); Apis nuluensis (Ay721717) (Arias, Sheppard, 2005).
Using cluster analysis we construct dendrogram by neighbor-joining method. On dendrogram bee samples had differentiated into four branches. Samples of different bee species clustered in separate branches. The first branch included samples of western honeybee Apis mellifera. Apis mellifera mellifera from Ural located separately from other subspecies. Samples of gigantic Asian bees of genus Apis have differentiated into a second branch of Apis dorsata. Asian bees of species Apis koschevnikovi and Apis nuluensis included into a third branch. These two bee species had low level of genetic differentiating among themselves. The fourth branch included bee species of Asian dwarf bees of species Apis andreniformis and Apis florea. Bee samples of each of them separated in different subgroups.
  076. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Cравнительный секвенционный анализ вариабельного интрона гена фактора элонгации 1 альфа ядерного генома пчел рода Apis. В мире научных открытий. 2010. № 3 (09). Ч.3. С. 33-35.  

Нами был использован сравнительный секвенционный анализ вариабельного интрона гена фактора элонгации EF-1а ядерной ДНК с целью определения филогенетического паттерна пчел рода Apis. На дендрограмме наблюдается разделение на четыре группы, где в 1 группу вошли подвиды Apis mellifera, во 2 группу – представители гигантских пчел Apis dorsata, 3 группу – виды Apis koschevnikovi и Apis nuluensis, в 4 группу – карликовые пчелы Apis andreniformis и Apis florea.
Ключевые слова: Apis mellifera mellifera, Apis, медоносная пчела, интрон гена фактора элонгации EF-1a, секвенирование, кластерный анализ, дендрограмма, филогенетика.
We used comparative analysis sekventsionny variable intron of elongation factor EF-1 a nuclear DNA in order to determine the phylogenetic pattern of bees genus Apis. In the observed dendrogram divided into four groups, where one group comprised subspecies Apis mellifera, the 2nd group - representatives of giant bees Apis dorsata, group 3 - species Apis koschevnikovi and Apis nuluensis, 4 group - dwarf bee Apis andreniformis and Apis florea.
Keywords: Apis mellifera mellifera, Apis, honeybee, intron gene elongation factor EF-1a, sequencing, cluster analysis, dendrogram, phylogenetics.
  075. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Генетический полиморфизм медоносной пчелы Apis mellifera mellifera L. южно-уральской горно-лесной популяции. Материалы Всероссийской научно-практической конференции "Актуальные проблемы сохранения биоразнообразия на охраняемых и иных территориях". Уфа. 2010. С. 190-193.  

Целью нашей работы был анализ молекулярно-генетической структуры бурзянской популяции Apis mellifera mellifera L., определение фаниц ареала и оценка степени ее полиморфизма. Для решения этих задач, с мая по сентябрь 2009 года, были взяты пробы в значительной части Бурзянского района, а также в сопредельных населенных пунктах Абзелиловского, Кугарчинского, Белорецкого, Баймакского и Зилаирского районов. Всего нами было собрано 695 образцов пчел со 119 пасек и И бортей. Материал исследовался на подвидовую принадлежность, частоту встречаемости аллелей, разнообразие генотипов. Нами был изучен полиморфизм микросатсллитных локусов ар243, 4а110, ар049, а24 ядерной ДНК. По результатам анализа частот аллелей микросатсллитных локусов были получены генетические расстояния, на основе которых кластерным анализом методом ближайшего соседа была построена дендрофамма генетических отношений населений пчел изучаемых нами популяций. На дендрофамме наблюдалось подразделение на 3 крупные ветви. Первая ветвь включала население пчел д. Атиково Бурзянского района, д. Иргизлы Бурзянского района, д, Старомусятово Бурзянского района, д. Новомусятово Бурзянского района; вторая - д. Кана Бурзянского района, д. Старосубхангулово Бурзянского района, д. Крутой лог Абзелиловского района, д. Сюрень Кугарчинского района; третья - д. Ямашево Бурзянского района. По результатам анализа наблюдаемых и ожидаемых частот генотипов микросателлитных локусов ар243, 4аПО, ар049, а24 ядерной ДНК был рассчитан коэффициент инбридинга Fis для изучаемых нами субпопуляций. Наибольший уровень инбридинга наблюдается в центре популяции (Fis изменялся от 0,22 до 0,45), а наименьший, максимально приближенный к состоянию равновесия - в д. Атиково Бурзянского района (Fis=0,15) и д. Сюрень Кугарчинского района республики Башкортостан (Fis=0,12). Для всех субпопуляций характерно наличие инбридинга и отсутствие аутбридинга. Таким образом, анализ полиморфизма ядерной и митохондриальной ДНК показал, что бурзянская популяция сохранилась практически чистопородной. Определилась часть фаниц ареала бурзянской популяции: северные (Белорецкий р-н), восточные (Абзелиловский р-н), юго-восточные (Баймакский р-н) и западные (Кугарчинекий, Мелеузовский и Ишимбайский районы). Установлено, что часть фаницы ареала бурзянской популяции медоносной пчелы проходит непосредственно по фанице с Кугарчи неким районом, гибридизованные пчелиные семьи могут находиться в непосредственной близости к заповеднику Шульган-Таш в его юго-западной части. Анализ полиморфизма выборок из Абзелиловского, Баймакского, Белорецкого ^ Зилаирского районов, может быть подтверждением гипотезы о более широком ареале бурзянской популяции медоносной пчелы Apis mellifera mellifera.

The aim of our work was to analyze the molecular genetic structure Burzyan populations Apis mellifera mellifera L., fanits definition and assessment of the range of its polymorphism. To solve these problems, from May to September 2009, samples were taken in a large part of Burzyansky area, as well as in the neighboring Abzelilovsky settlements, Kugarchinskogo, Beloretsk, Baimak and Zilair areas. In total we collected 695 samples of bees and apiaries with 119 and sides. The material was investigated on subspecies, the frequency of alleles, diversity of genotypes. We have studied the polymorphism loci mikrosatsllitnyh ar243, 4a110, ar049, A24 nuclear DNA. According to the analysis of allele frequencies mikrosatsllitnyh genetic loci were obtained distances at based cluster analysis method was nearest neighbor It built dendrofamma genetic attitude of the population of bees we study populations. On dendrofamme observed Unit 3 large branches. The first branch included population bee d. Atikovo Burzyansky area on. Irgizly Burzyansky area, etc., Staromusyatovo Burzyansky district, d. Novomusyatovo Burzyansky area; second - d. Burzyansky Cana region, d. Starosubhangulovo Burzyansky district, d. Abrupt log Abzelilovsky district, d. Suresnes Kugarchinskogo area; third - d. Yamasheva Burzyansky area. According to the analysis of the observed and expected frequencies genotypes of microsatellite loci ar243, 4aPO, ar049, A24 nuclear DNA was calculated inbreeding coefficient Fis we study subpopulations. The highest level of inbreeding observed in the center population (Fis varied from 0.22 to 0.45), and the lowest maximum close to equilibrium - in the village. Atikovo Burzyansky District (Fis = 0,15) and d. Kugarchinskogo Suresnes district of the republic Bashkortostan (Fis = 0,12). For all subpopulations characterized inbreeding and outbreeding absence. Thus, the analysis of polymorphisms of nuclear and mitochondrial DNA showed that the population remained Burzyan almost thoroughbred. Determine the area of ​​the fanits Burzyan population: the northern (Beloretsk district), eastern (Abzelilovsky district), southeastern (Baimaksky district), and Western (Kugarchineky, Meleuzovsky and Ishimbay areas). INSTALLATIONS, that part of the area fanitsy Burzyan honeybee population It goes directly to fanitse Kugarchi certain area, hybridized bee colonies may be in close proximity to the reserve Shulgan-Tash in its southwestern part. Analysis polymorphism in samples from Abzelilovsky, Baimak, Beloretsk ^ Zilair areas can be confirmation of the hypothesis of a more wide area Burzyan population of honey bee Apis mellifera mellifera.

  074. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Генное разнообразие медоносной пчелы в локальной популяции на севере республики Башкортостан. Материалы III Всероссийской научно-практической конференции "Биологические системы: устойчивость, принципы и механизмы функционирования". Нижний Тагил. 2010. С. 261.

Генное разнообразие является важнейшей характеристикой популяций, позволяющей определить ее устойчивость в целом. Целью нашей работы являлось изучение на основе анализа полиморфизма 5 микросателлитных локусов (Ap243, 4a110, A8, A43, A113) ядерной ДНК генетического разнообразия локальной популяции пчел на территории двух северных районов республики Башкортостан (Балтачевский (N=36) и Бирский(N=65)), ранее отнесенный нами к части ареала A.m.mellifera башкирского экотипа.
Таблица 1
Основные генетические характеристики локальной популяции медоносной пчелы республики Башкортостан
Локус    Ho    Hs    Ht    Fis    Qintra    Qinter    Fst    Fit    Hбалт    Hбир
Ap243    0,272    0,539    0,536    0,478    0,283    0,542    -0,010    0,473    0,525    0,552
4a110    0,527    0,531    0,530    0,009    0,533    0,537    -0,004    0,005    0,501    0,561
A8    0,371    0,409    0,425    0,107    0,391    0,438    0,069    0,169    0,274    0,543
A43    0,460    0,428    0,444    -0,124    0,500    0,445    0,066    -0,050    0,352    0,505
A113    0,091    0,187    0,187    0,524    0,087    0,183    0,001    0,524    0,525    0,552
Все    0,344    0,419    0,424    0,164    0,359    0,429    0,026    0,185    0,501    0,561
По результатам анализа полиморфизма 5 микросателлитных локусов (Ap243, 4a110, A8, A43, A113) ядерной ДНК нами были рассчитаны показатели F-статистики и гетерозиготности (Таб. 1). Популяция в целом по всем локусам испытывает незначительный дефицит гетерозигот Ho (0,344)< Hs (0,419), Ht (0,424) и Fit (0,185). Генное разнообразие в популяции пчел Бирского района Hбир (0,466)> чем Балтачевского Hбалт (0,372). Среднее генное разнообразие по всем локусам внутри особи Qintra (0,359)< чем между особями Qinter (0,429). Гетерозиготность на уровне субпопуляций Hs (0,419)< гетерозиготности для всей популяции Hs (0,424). Коэффициент дифференциации Fst (0,026) показывает очень малую степень внутрипопуляционной локальной дифференциации.
Таким образом, можно предположить, что в локальной популяции пчел двух районов республики Башкортостан (N=101) наблюдается отсутствие подразделенности и небольшая степень генетической изоляции. Предполагается, что между локальными популяциями пчел этих двух районов возможен неограниченный поток. Большой запас генного разнообразия обнаруживается на межпопуляционном уровне. По частотам генотипов не наблюдается значительного отклонения от равновесия Харди-Вайнберга.
Genetic diversity of honey bees in locales Noi POPULATION IN THE NORTH BASHKORTOSTAN
Genetic diversity is an essential characteristic of populations, allowing to determine its stability as a whole. The aim of our work was to study the analysis of polymorphism of 5 microsatellite loci (Ap243, 4a110, A8, A43, A113) nuclear DNA genetic diversity of local bee populations in the two northern regions of the Republic of Bashkortostan (Baltachevsky (N = 36) and Birsky (N = 65 )) was originally classified as a part of our range Ammellifera Bashkir ecotype.
Table 1
Main genetic characteristics of local honeybee population of the republic of Bashkortostan
Locus Ho Hs Ht Fis Qintra Qinter Fst Fit Hbalt Hbir
Ap243 0,272 0,539 0,536 0,478 0,283 0,542 -0,010 0,473 0,525 0,552
4a110 0,527 0,531 0,530 0,009 0,533 0,537 -0,004 0,005 0,501 0,561
A8 0,371 0,409 0,425 0,107 0,391 0,438 0,069 0,169 0,274 0,543
A43 0,460 0,428 0,444 -0,124 0,500 0,445 0,066 -0,050 0,352 0,505
A113 0,091 0,187 0,187 0,524 0,087 0,183 0,001 0,524 0,525 0,552
All 0.344 0.419 0.424 0.164 0.359 0.429 0.026 0.185 0.501 0.561
According to the analysis of polymorphism of 5 microsatellite loci (Ap243, 4a110, A8, A43, A113) nuclear DNA we calculated indicators F-statistics and heterozygosity (Tab. 1). The population as a whole for all loci experiencing a slight deficit of heterozygotes Ho (0,344) <Hs (0,419), Ht (0,424) and Fit (0,185). Genetic diversity in the population of bees Birsk district Hbir (0.466)> than Baltachevskogo Hbalt (0,372). Average genetic diversity for all loci in individuals Qintra (0,359) <than between individuals Qinter (0,429). Heterozygosity at subpopulations Hs (0,419) <heterozygosity for the entire population Hs (0,424). Differentiation factor Fst (0,026) shows a very low degree of intra-local differentiation.
Thus, we can assume that the local bee population of the two districts of the republic of Bashkortostan (N = 101), there is a lack of units and a small degree of genetic isolation. It is assumed that between the local bee population of the two areas is unrestricted flow. Large stock of genetic diversity found in the interpopulation level. At frequencies of genotypes no significant deviation from Hardy-Weinberg equilibrium. 
  073. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Оценка генетического разнообразия в локальной популяции медоносной пчелы двух районов республики Башкортостан. Материалы I Всероссийской научно-практической конференции с международным участием "Проблемы сохранения биологического разнообразия волжского бассейна и сопредельных территорий". Чебоксары. 2010. С. 35-36.  

Генетическое разнообразие является главным показателем процессов, происходящих в популяции. На основе гетерозиготности также рассчитываются коэффициенты инбридинга популяции - основные показатели генетической структуры популяции. Целью нашей работы стало изучение генетического разнообразия популяции пчел на территории двух северных районов (Балтачевский и Бирский) Республики Башкортостан (табл. 1, рис. 1) на основе анализа полиморфизма 5 микросателлитных локусов (Ар243, 4а110, А8, А43, А113) ядерной ДНК. Fst - средний уровень генетической дифференциации между субпопуляциями; Fis - средний уровень инбридинга и отклонение от пропорций Харди-Вайнберга внутри субпопуляций; Fit - средний уровень инбридинга и отклонение от пропорций Харди-Вайнберга во всей популяции; Но - средняя наблюдаемая гетерозиготность внутри субпопуляций между локусами; Hs - средняя ожидаемая гетерозиготность внутри субпопуляций между локусами; Ht - средняя ожидаемая гетерозиготность во всей популяции между локусами; Qintra - среднее генное разнообразие внутри особей; Qinter - среднее генное разнообразие между особями; Нбалт - генное разнообразие в локальной популяции пчел на территории Балтачевского района Республики Башкортостан; Нбир - генное разнообразие в локальной популяции пчел на территории Бирского района Республики Башкортостан. По результатам анализа полиморфизма 5 микросателлитных локусов (Ар243, 4а110, А8, А43, А113) ядеркой ДНК нами были рассчитаны такие показатели F-статистики и гетерозиготности (табл. 2). Как видно из таблицы, популяция в целом по всем локусам испытывает очень незначительный дефицит гетерозигот Но (0,344)< Hs (0,419) и Ht (0,424). О дефиците гетерозигот говорит и Fis (0,164) для субпопуляций и Fit (0,185). Однако, по некоторым локусам (А43) наоборот наблюдается избыток гетерозигот Но (0,460)< Hs (0,428) и Ht (0,444), a Fis (-0,124) и Fit (-0,050). Оценка генного разнообразия по всем локусам для локальных популяций каждого района Республики Башкортостан показывает, что оно больше в популяции пчел Бирского района Нбир (0,466)> Нбалт (0,372), однако по некоторым локусам (А113) генное разннобразие больше в популяции пчел Балтачевского района Нбир (0,206)> Нбалт (0,168). Оценка среднего генного разнообразия по всем локусам внутри (Qintra) и между особями (Qinter) в локальной популяции пчел двух районов республики Башкортостан показала, что Qintra (0,359)< Qinter (0,429). Однако по некоторым локусам (А43) Qintra (0,500)> Qinter (0,445). Такие же результаты дает гетерозиготность, которая на уровне субпопуляций Hs (0,419) меньше гетерозиготности для всей популяции Hs (0,424). Коэффициент дифференциации популяций в локальной популяции пчел двух районов Республики Башкортостан Fst (0,026), что очень близко к нулевому значению. Это показывает очень малую степень внутрипопуляционной локальной дифференциации. По некоторым локусам (А8 и А43) Fst (0,069) и (0,066), что немного больше значения Fst по всем локусам. Таким образом, можно предположить, что в локальной популяции пчел двух районов (Бирский и Балтачевский) Республики Башкортостан происходит небольшая степень изоляции от потока генов из других локальных популяций пчел, что и привело к таким значениям коэффициентов инбридинга Fis и Fit, Также возможно, что отсутствие подраз- деленности популяций пчел двух районов республики Башкортостан является дополнительной причиной положительных значений коэффициентов инбридинга. Близкое к нулю значение коэффициента подраэделенности свидетельствует о неограниченном потоке генов и миграции между локальными популяциями пчел двух районов (Бирский и Балтачевский) Республики Башкортостан, несмотря на их некоторую незначительную географическую разобщенность. Генное разнообразие между особями больше, чем внутри особей в среднем, что выявляет запас генного разнообразия на популяционном уровне. Это может обеспечивать популяцию запасом устойчивости и изменчивостью на популяционном уровне.
Genetic diversity is the main indicator of the processes occurring in the population. Based heterozygosity and inbreeding coefficients calculated the population - the main indicators of the genetic population structure. The aim of our work was to study the genetic diversity of the population of bees in the territory two northern districts (Baltachevsky and Birsky) RB (Table. 1, Fig. 1) based on an analysis 5 microsatellite loci polymorphism (Ar243, 4a110, A8, A43, A113) of nuclear DNA. Fst - the average level of genetic differentiation between subpopulations; Fis - the average level of inbreeding and deviation from Hardy-Weinberg proportions within subpopulations; Fit - the average level of inbreeding and the deviation from Hardy-Weinberg proportions in the general population; But - the average observed heterozygosity in subpopulations between loci; Hs - the average expected heterozygosity in subpopulations between loci; Ht - average expected heterozygosity in the total population between loci; Qintra - the average gene diversity within individuals; Qinter - the average genetic diversity between individuals; Nbalt - genetic diversity in the local population bee on the territory of the Republic of Bashkortostan Baltachevskogo area; Nbir - genetic diversity in the local bee population in the territory of the Republic of Bashkortostan Birsk area. According to the analysis of polymorphism of 5 microsatellite loci (Ar243, 4a110, A8, A43, A113) Yaderku DNA we calculated these indicators F-statistics and heterozygosity (Table. 2). As the table shows, the population of in general, all the loci experiencing very small deficit of heterozygotes But (0,344) <Hs (0,419) and Ht (0.424). The deficit of heterozygotes and says Fis (0,164) for the subpopulations and Fit (0,185). However, for some loci (A43) on the contrary there is an excess of heterozygotes But (0,460) <Hs (0,428) and Ht (0,444), a Fis (-0,124) and Fit (-0,050). Assessment of genetic diversity for all loci for local populations of each region of the Republic of Bashkortostan shows that it is more in the bee population Birsk area Nbir (0.466)> Nbalt (0.372), but for some loci (A113) gene raznnobrazie more in the bee population Baltachevskogo district Nbir (0.206)> Nbalt (0.168). Estimate of the average gene diversity at all loci in (Qintra) and between individuals (Qinter) local bee population of the two districts of the republic of Bashkortostan showed that Qintra (0,359) <Qinter (0,429). However, some loci (A43) Qintra (0,500)> Qinter (0,445). The same results are obtained heterozygosity at which subpopulations Hs (0,419) less heterozygosity for the entire population Hs (0,424). The coefficient of differentiation of populations in the local bee population of the two districts of the Republic of Bashkortostan Fst (0,026), which is very close to zero. It shows a very low degree of intra- local differentiation. For some loci (A8 and A43) Fst (0,069) and (0,066), which is slightly greater than the Fst all loci. Thus, we can assume that the local bee population of two districts (Birsky and Baltachevsky) Republic of Bashkortostan takes a small degree of isolation from the flow of genes from other local populations bees, which led to such a coefficient of inbreeding Fis and Fit, also possible that the absence of podraz- concreteness bee populations of two districts of the Republic of Bashkortostan is an additional reason for the positive coefficient of inbreeding. Close to zero coefficient indicates podraedelennosti of unlimited gene flow and migration between the local bee population of two districts (Birsky and Baltachevsky) of the Republic of Bashkortostan, despite some minor geographical fragmentation. Genetic diversity between individuals is greater than the average within the individuals that brings the stock of genetic diversity at the population level. This may provide population stability margin and volatility the population level. 
  072. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Охрана башкирской пчелы в заповеднике Шульган-Таш. Материалы 3 Международной научно-практической конференции "Сохранение разнообразия животных и охотничье хозяйство России". Москва. 2009. С.36-37.  

Первоначально ареал медоносной пчелы Apis mellifera mellifera L. охватывал обширную территорию от Британских островов до Урала, вдоль северной границы распространения вида. На данный момент ее ареал значительно сократился из-за внутривидовой гибридизации. Считается, что в настоящее время в Западной Европе практически невозможно найти негибридизованные семьи A.m.mellifera. В нашей стране A.m.mellifera также была подвержена интенсивной гибридизации в результате завоза пчел из южных регионов страны. Однако предполагалось, что в отдельных местах еще могли сохраниться популяции A.m.mellifera. Среди сохранившихся локальных популяций A.m.mellifera особо выделяется популяция башкирских бортевых пчел Бурзянском районе республики Башкортостан и взятая под охрану в заповеднике «Шульган-таш».
В 1958 году для охраны сохранившихся пчел A.m.mellifera в Бурзянском районе Республики Башкортостан был создан Заповедник «Шульган-таш» как филиал «Прибельский» восстанавливаемого Башкирского Государственного заповедника. В 1986 году по постановлению Совета Министров РСФСР от 6 января он преобразован в самостоятельный заповедник. Правительство РБ, администрации Бурзянского района и заповедника Шульган-Таш уделяют большое внимание сохранению бурзянской популяции. Большую помощь оказывают также международные организации, в частности, Всемирный фонд охраны дикой природы (WWF). На территории заповедника ведется племенная работа, администрацией района издан указ о запрете на ввоз пчел других подвидов, в 1997 году создан заказник «Алтын Солок». В 1997 году был создан заказник «Алтын Солок» и выделился как подразделение Бурзянского лесхоза. В зоне заказника находилось около 800 бортей, более 50 человек занимались бортничеством. В конце 80-х годов администрациями района и Республики был издан указ, запрещающий ввоз пчёл других подвидов на территорию района.
Одним из основных объектов охраны заповедника является башкирская пчела Бурзянского района, которая является достоянием Республики Башкортостан. Эта пчела отличаются чрезвычайной работоспособностью: в течение двух-трех недель цветения липы они могут работать с раннего утра до позднего вечера и способны даже в дождливую погоду, совершать огромное число вылетов, и собирать до 10 кг нектара в день.
Бортевые пчелы существуют в естественной среде, в суровых условиях и подвержены жесткому естественному отбору. Однако они не могут существовать абсолютно изолированно от пасек. Так как сама популяция бортевых пчел небольшая, она нуждается в постоянном пополнении за счет пасечных пчел. Поэтому окружающие пасеки играют большую роль. Между бортевыми пчелами и пасечными идет постоянная миграция, и эти процессы помогают сохранить популяцию. Подтверждением этого факта может послужить опыт Южноуральского заповедника, где с исчезновением деревень полностью исчезли и бортевые пчелы, хотя сами борти сохранились.
В настоящее время намечается расширение территории заповедника Шульган-Таш, что поможет сохранить биологическое и ландшафтное разнообразие широколиственных лесов, а, следовательно, и сохранить среду обитания бурзянских пчел. Расширение планируется примерно на 36 тыс. га в западном направлении. Там находятся неосвоенные территории на стыке Мелеузовского, Ишимбайского и Бурзянского районов, где нет населенных пунктов, животноводческих объектов, лесозаготовок и сохранились нетронутые человеком леса. В результате площадь охраняемых мест обитания бурзянской пчелы вместе с национальным парком «Башкирия» и заказником «Алтын Солок» может увеличиться до 230 тыс. га. При учреждении заповедника Шульган-Таш в его собственность были переданы около 900 бортей, правда лишь треть из них оказалась пригодной для эксплуатации. Поэтому в заповеднике ведется также работа по изготовлению и оснащению бортей.
На данный момент нет данных о границе распространения популяции бурзянских пчел. Для первоначальных исследований с целью определения распространения бурзянских пчел были отобраны пчелы из 5 выборок: с. Старосубхангулово, с. Новомусятово, с. Иргизлы Бурзянского района, с. Крутой Лог Абзелиловского района, с. Сюрень Кугарчинского района Республики Башкортостан. В исследовании были использованы: локус COI-COII мтДНК, микросателлитные локусы ap243, 4a110, a8, a43 ядерной ДНК. Нами были рассчитаны частоты встречаемости аллелей каждого локуса.
Частоты встречаемости комбинаций межгенного локуса COI-COII мтДНК были следующими: в популяциях пчел всех выборок, кроме Сюрени, комбинация PQQ (маркер A.m.mellifera) встречалась с частотой 1,0, тогда как в Сюрени встречалась только комбинация Q (маркер A.m.caucasica) с частотой 1,0.  Для получения информации о распределении популяций необходимо рассчитать частоты аллелей и генетические расстояния.
На основе данных о частотах распределения аллелей были рассчитаны генетические расстояния. Наибольшие расстояния наблюдается между популяциями Сюрень и Крутой Лог; Сюрень и Старосубхангулово. Наименьшие расстояния - между Крутой Лог и  Новомусятово; Старосубхагулово и  Новомусятово. Такая группировка, в некоторой степени согласована как с географическим расположением, так и генетическим составом этих популяций. В дальнейшем, был проведен кластерный анализ с использованием метода ближайшего соседа и построена дендрограмма. Так, популяция Сюрень отделяется от всех, так как в ней представлены в основном гибридные семьи пчел. Картина кластерного анализа может отражать до некоторой степени уровень миграции между популяциями, где наиболее близкие популяции будут близки и генетически, тогда как отдаленные популяции будут более изолированы друг от друга.
Таким образом, проведенные исследования позволяют сделать вывод о том, что ареал обитания бурзянской популяции башкирской пчелы A.m.mellifera, возможно имеет расширение в восточном направлении в сторону Абзелиловского района, тогда как на юге в Кугарчинском районе популяция была подвержена значительной гибридизации.
The original area of ​​the honey bee Apis mellifera mellifera L. covers a vast area from the British Isles to the Urals, along the northern border of the species distribution. At the moment, its range is much reduced because of intraspecific hybridization. It is estimated that currently in Western Europe is almost impossible to find a non-hybridized family Ammellifera. In our country Ammellifera was also subject to intense hybridization resulting in the importation of bees from the southern regions of the country. However, it was assumed that in some places could still keep the population Ammellifera. Among the remaining local populations Ammellifera highlights Bashkir wild-hive bee population Burzyan region of the republic of Bashkortostan and protected in the reserve "Shulgan-Tash."
In 1958, for the protection of the surviving bees Ammellifera Burzyan area in the Republic of Bashkortostan was established reserve "Shulgan-Tash" as a branch of "Pribelsky" restores the Bashkir State Nature Reserve. In 1986, by order of the RSFSR Council of Ministers of January 6, it is converted into a separate reserve. The Government of the Republic of Belarus, and the district administration Burzyansky Reserve Shulgan-Tash pay great attention to the preservation Burzyan population. Most care is provided by international organizations, in particular, the World Wildlife Fund (WWF). Within the reserve is being breeding work, the district administration issued a decree banning the importation of bees other subspecies in 1997 created reserve "Altyn Solok". In 1997, the reserve was established "Altyn Solok" and stood out as a division Burzyansky forestry. In the area of ​​the reserve was about 800 board, more than 50 people were engaged in apiculture. In the late 80-ies of the district administration and the Republic issued a decree banning the importation of bees other subspecies in the territory of the region.
One of the main objects of protection is to preserve the Bashkir bee Burzyansky district, which is the property of the Republic of Bashkortostan. This bee are extremely operability: within two or three weeks of flowering linden they can work from early morning until late at night and can even in the rain, to make a huge number of missions, and collect nectar up to 10 kg per day.
Wild-hive bee exist in the natural environment, in harsh conditions, and are subject to strict natural selection. However, they can not be completely isolated from the apiaries. Since the very small population of wild-hive of bees, it needs constant replenishment due apiary bees. So the surrounding apiaries play a big role. In the wild-hive bees and beekeeping is a constant migration, these processes help keep the population. Proof of this fact can serve as the experience of South Ural Reserve, where the disappearance of the villages have completely disappeared and wild-hive bee, though they remained aboard.
Currently planned expansion of the reserve Shulgan-Tash, which will help keep the biological and landscape diversity of deciduous forests, and, consequently, save the environment Burzyan bees. The expansion is scheduled for about 36 thousand. Ha in the western direction. There are undeveloped territory at the junction Meleuzovsky, Ishimbaisky Burzyansky and areas where there are no settlements, livestock facilities, harvesting and preserved untouched by man of the forest. As a result, the area of ​​protected habitat Burzyan bee along with the national park "Bashkiria" and reserve "Altyn Solok" may increase up to 230 thousand. Ha. In establishing the reserve Shulgan-Tash in his possession were handed over about 900 board, though only a third of them turned out to be suitable for use. Therefore, the reserve is also ongoing work on the construction and equipping of the board.
There is currently no data on the spread of the border population Burzyan bees. For the initial studies to determine the spread of Burzyan bee bees were selected from 5 samples: a. Starosubhangulovo with. Novomusyatovo with. Irgizly Burzyansky district with. Krutoy Log Abzelilovsky district with. Suresnes Kugarchinskogo district of Bashkortostan. The study used: locus COI-COII mtDNA microsatellite loci ap243, 4a110, a8, a43 nuclear DNA. We calculated the frequency of alleles for each locus.
The frequency of occurrence of combinations intergenic locus COI-COII mtDNA were as follows: in populations of bees of all samples except Suresnes combination PQQ (marker Ammellifera) occurs with a frequency of 1.0, whereas in Suresnes met only the combination Q (marker Amcaucasica) with frequency 10. For information on the distribution of populations is necessary to calculate allele frequencies and genetic distances.
Based on the distribution of allele frequencies were calculated genetic distance. The greatest distance observed between populations of Suresnes and Krutoy Log; Suresnes and Starosubhangulovo. The shortest distance - between Krutoy Log and Novomusyatovo; Starosubhagulovo and Novomusyatovo. This grouping, to some extent consistent with both the geographical location and the genetic composition of populations. Further, the cluster analysis was conducted using the method of the nearest neighbor and constructed dendrogram. Thus, the population is separated from all of Suresnes, since it contains mainly hybrid bee colonies. Painting cluster analysis may reflect to some degree the level of migration between populations where populations are closest and genetically close, while more distant populations are isolated from each other.
Thus, our studies suggest that habitat Burzyan Bashkir bee populations Ammellifera, perhaps has the extension eastwards towards Abzelilovsky area, while in the south district Kugarchinskom population exposed to significant hybridization.
  071. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Распределение аллелей микросателлитных локусов и локуса COI-COII мтДНК в популяции южной части ареала башкирских пчел. Материалы II Всероссийской конференции студентов, аспирантов и молодых учёных "Полевые и экспериментальные исследования биологических систем". Ишим. 2009. С. 70-75.  

Задачей нашего исследования является изучение популяций пчел южной части ареала башкирской пчелы. Ранее проведенные нами исследования показали, что башкирские пчелы по таксономии относятся к подвиду A.m.mellifera. Первоначально единственным местом сохранения чистых линий этой пчелы считался небольшой регион на юге Башкортостана, входящий в состав заповедника «Шульган-Таш» Республики Башкортостан. Дальнейшие исследования относились преимущественно к северной части ареала башкирской пчелы и не было проведено каких-либо исследований в обнаруженной первоначально популяции A.m.mellifera южной части ареала. Ареал этой южной локальной популяции не определен в точности, а именно, совпадает ли ареал с границами Бурзянского района или он гораздо шире.
Для исследования были отобраны пчелы из 5 выборок: с. Старосубхангулово (10 семей), с. Новомусятово (10 семей), с. Иргизлы (10 семей) Бурзянского района, с. Крутой Лог (5 семей) Абзелиловского района, с. Сюрень (4 семьи) Кугарчинского района Республики Башкортостан (рис. 1). В исследовании были использованы: локус COI-COII мтДНК, микросателлитные локусы ap243, 4a110, a8, a43 ядерной ДНК. Нами были рассчитаны частоты встречаемости аллелей каждого локуса.
Частоты встречаемости комбинаций межгенного локуса COI-COII мтДНК были следующими: в популяциях пчел всех выборок, кроме Сюрени, комбинация PQQ (маркер A.m.mellifera) встречалась с частотой 1,0, тогда как в Сюрени встречалась только комбинация Q (маркер A.m.caucasica) с частотой 1,0. Частоты аллелей микросателлитных локусов в изучаемых выборках Старосубхангулово, Новомусятово, Иргизлы, Крутой Лог и Сюрень представлены в таблице (таб. 1).  Для получения информации о распределении популяций необходимо рассчитать по частотам генетические расстояния. Наиболее приемлемым расстоянием является генетическое расстояние M. Nei (1978).
На основе данных о частотах распределения аллелей были рассчитаны генетические расстояния (таб. 2). Наибольшие расстояния наблюдается между популяциями Сюрень и Крутой Лог; Сюрень и Старосубхангулово. Наименьшие расстояния - между Крутой Лог и  Новомусятово; Старосубхагулово и  Новомусятово. Такая группировка, в некоторой степени согласована как с географическим расположением, так и генетическим составом этих популяций. В дальнейшем, был проведен кластерный анализ с использованием метода ближайшего соседа и построена дендрограмма (рис. 2). Так, популяция Сюрень отделяется от всех, так как в ней представлены в основном гибридные семьи пчел. Таким образом, картина кластерного анализа может отражать до некоторой степени уровень миграции между популяциями, где наиболее близкие популяции будут близки и генетически, тогда как отдаленные популяции будут более изолированы друг от друга.
Таким образом, проведенные исследования позволяют сделать вывод о том, что популяция южного ареала башкирских пчел A.m.mellifera, возможно имеет расширение в восточном направлении в сторону Абзелиловского района, тогда как на юге в Кугарчинском районе популяция была подвержена значительной гибридизации.
The aim of our research is to study the bee populations of southern part of the range of Bashkir bee. Earlier studies have shown us that the Bashkir bee taxonomy are subspecies Ammellifera. Initially, the only place save the clean lines of the bees was considered a small region in the south of Bashkortostan, which is part of the reserve "Shulgan-Tash" of the Republic of Bashkortostan. Further studies are concerned mainly to the northern part of the range of Bashkir bee and was not carried out any research in the detected initial population Ammellifera southern part of the range. The area south of the local population is not defined precisely, but it coincides with the boundaries of any area or district Burzyansky it is much wider.
For the study were selected from bees 5 samples: p. Starosubhangulovo (10 families), p. Novomusyatovo (10 families), p. Irgizly (10 families) region Burzyansky with. Krutoy Log (5 families) region Abzelilovsky with. Suresnes (4 families) region of the Republic of Bashkortostan Kugarchinskogo (Fig. 1). The study used: locus COI-COII mtDNA microsatellite loci ap243, 4a110, a8, a43 nuclear DNA. We calculated the frequency of alleles for each locus.
The frequency of occurrence of combinations intergenic locus COI-COII mtDNA were as follows: in populations of bees of all samples except Suresnes combination PQQ (marker Ammellifera) occurs with a frequency of 1.0, whereas in Suresnes met only the combination Q (marker Amcaucasica) with frequency 10. Allele frequencies of microsatellite loci in the study sample Starosubhangulovo, Novomusyatovo, Irgizly, Krutoy Log Suresnes and presented in a table (Table. 1). To obtain information about the distribution of the populations must be calculated for the frequency of genetic distance. The most acceptable is genetic distance distance M. Nei (1978).
On the basis of data on the distribution of allele frequencies were calculated genetic distances (Table. 2). The greatest distance observed between populations of Suresnes and Krutoy Log; Suresnes and Starosubhangulovo. The shortest distance - between Krutoy Log and Novomusyatovo; Starosubhagulovo and Novomusyatovo. This grouping, to some extent consistent with both the geographical location and the genetic composition of populations. Subsequently, a cluster analysis was performed using the nearest neighbor method and a dendrogram constructed (Fig. 2). Thus, the population is separated from all of Suresnes, since it contains mainly hybrid bee colonies. Thus, the picture cluster analysis may reflect to some degree the level of migration between populations where populations are closest and genetically close, while more distant populations are isolated from each other.
Thus, the studies suggest that the population of the southern area of ​​the Bashkir bee Ammellifera, perhaps has the extension eastward toward Abzelilovsky area, whereas in the south neighborhood Kugarchinskom population exposed to significant hybridization.
  070. Ильясов Р.А., Шареева З.В. , Поскряков А.В., Николенко А.Г. Гетерогенность популяции северной части ареала башкирской пчелы. Материалы V Международной научной конференции "Факторы экспериментальной эволюции организмов". Алушта. 2009.С. 138-140.

Микросателлитный локус ap243 был представлен тремя аллелями 1, 2 и 2. При этом с максимальной частотой 0,80 аллель 1 была представлена в гибридной иглинской выборке, а в остальных колебалась в пределах 0,42 – 0,58, тогда как караидельская выборка имела промежуточное значение 0,70. Напротив, аллель 2 была минимальна в иглинской выборке (0,12), а в остальных варьировала в диапазоне 0,23-0,40. Реже всего встречалась аллель 3, частота которой в изучаемых выборках (за исключением бурзянской) в основном не превышала величины 0,10. В выборке из бурзянской популяции аллель 3 была представлена с частотою 0,35, что можно предположить в качестве маркера южной башкирской популяции. Распределение генотипов данного локуса показало, что наиболее представлен генотип 11 с частотой от 0,29 (бурзянская) до 0,70 (иглинская). Генотип 23 в бирской, караидельской и татышлинской популяциях отсутствовал. Гибридная иглинская популяция явно отличалась от остальных по частотам генотипа 11 – 0,70 и генотипа 22 – 0,03. Среди оставшихся также наблюдалась некоторая подразделенность: бурзянская выборка выделялась по частоте 0,26 генотипа 33, а бирская – мишкинская – караидельская группа – по частоте от 0,26 до 0,38 генотипа 12.
По результатам анализа другого ядерного маркера, микросателлитного локуса 4а110, можно отметить, что аллели 1 и 2 были представлены практически в равных долях, тогда как аллель 3 встречалась очень редко, либо совсем отсутствовала в выборках. Наиболее часто встречались генотипы 11 (0,20-0,60), 22 (0,10-0,28) и 12 (0,30-0,49). Частота встречаемости генотипов 33, 13 и 23 по многим выборкам была низкой (<0,05), а в некоторых составляла 0. Иглинская выборка отличилась от других частотами аллеля 1 (0,75 против 0,45-0,57 у прочих) и аллеля 2 (0,25 против 0,43-0,52), а также частотами генотипа 11 (0,60 против 0,20-0,33) и генотипа 22 (0,10 против 0,20-0,28). Частоты аллелей и генотипов в других выборках были приблизительно равными.
При изучении микросателлитного локуса А8 ядерной ДНК в исследуемых выборках пчел был обнаружен более широкий спектр аллелей, по сравнению с другими локусами, число которых в отдельных выборках достигало 5 (4 и 5 аллели были обнаружены в единичных случаях). Наиболее часто встречались генотипы 11, 13 и 33. Генотипы 12, 14 и 15 встречались редко (<0,05), а генотипы 22, 44, 55, 24, 25, 35 и 45 отсутствовали. Иглинская популяция отличалась от прочих частотами аллеля 1 (0,48 против 0,69-0,96) и аллеля 3 (0,48 против 0,02-0,27). Остальные аллели встречались достаточно редко. Помимо этого иглинская популяция выделялась по частотам генотипа 11 (0,17 против 0,40-0,80) и генотипа 33 (0,20 – против 0,00-0,08). По частоте генотипа 13 караидельская выборка (0,50) приближалась к иглинской (0,57 против 0,04-0,17 у четырёх оставшихся).
Таким образом, нами были получены предварительные результаты по полиморфизму трех микросателлитных локусов ар243, 4а110 и А8 ядерной ДНК в исследуемых и сравниваемых выборках пчел. Результаты показывают, что популяции северной части ареала башкирской пчелы полиморфны по трем микросателлитным локусам, что характеризует их значительную генетическую гетерогенность и высокий уровень биоразнообразия. Полученные результаты будут служить основой для получения основных генетических характеристик популяций пчел северной части ареала республики Башкортостан.
Ap243 microsatellite loci was represented by three alleles 1, 2 and 2. In this case the maximum rate of 0.80 1 allele was represented in the hybrid Iglinsky sample, and the rest ranged from 0.42 - 0.58, while the sample had an intermediate karaidelskaya value of 0.70. In contrast, allele 2 has been minimal in Iglinsky sample (0.12), and in other varied in the range of 0,23-0,40. Less often found 3 allele whose frequency in the studied samples (except Burzyan) generally did not exceed 0.10. In a sample of the population Burzyan allele 3 was presented with a frequency of 0.35, which can be assumed as a marker of the southern Bashkir population. The genotype distribution of the loci showed that the most represented genotype frequencies between 11 0.29 (Burzyansky) 0.70 (Iglinskiy). Genotype 23 Birsk, karaidelskoy and tatyshlinskoy populations absent. Hybrid Iglinskiy population is clearly different from the rest of the genotype frequencies of 11 - 22 genotype and 0.70 - 0.03. Among the remaining also observed some units: Burzyan sampling frequency allocated 0.26 genotype 33 and Birsk - Mishkinskoye - karaidelskaya group - in frequency from 0.26 to 0.38 genotype 12.
According to the analysis of other nuclear marker, microsatellite loci 4a110, it may be noted that the alleles 1 and 2 were represented in almost equal proportions, while allele 3 is very rare, or completely absent in the samples. Most frequent genotypes 11 (0,20-0,60), 22 (0,10-0,28) and 12 (0,30-0,49). The frequency of genotypes 33, 13 and 23 in many samples was low (<0.05), and some was 0. Iglinskiy Picks distinguished from other frequencies of allele 1 (0,45-0,57 at 0.75 against others), and allele 2 (0.25 vs. 0,43-0,52) and genotype frequencies 11 (0.60 versus 0,20-0,33) and 22 genotype (0.10 vs. 0,20-0,28) . The frequencies of alleles and genotypes in other samples were approximately equal.
In the study of microsatellite loci A8 nuclear DNA in the test samples it was detected bees wider range of alleles, in comparison to other loci in which the number of individual samples reached 5 (4 and 5 alleles were detected in a few cases). Most frequent genotypes 11, 13 and 33 genotypes 12, 14, and 15 are rare (<0.05), and genotypes 22, 44, 55, 24, 25, 35 and 45 were absent. Iglinskiy population differed from the other allele frequencies of 1 (0.48 versus 0,69-0,96) and allele 3 (0.48 versus 0,02-0,27). The rest of the alleles are rare. Besides Iglinskiy population stood at 11 genotype frequencies (0.17 versus 0,40-0,80) and genotype 33 (0.20 - against 0,00-0,08). According to the frequency of the genotype 13 karaidelskaya sample (0.50) approached Iglinsky (0,04-0,17 at 0.57 against the remaining four).
Thus, we have obtained preliminary results of polymorphism of three microsatellite loci ar243, 4a110 A8 and nuclear DNA in the study and compared samples of bees. The results show that the population of the northern part of the range of Bashkir bee in three polymorphic microsatellite loci that characterizes their significant genetic heterogeneity and a high level of biodiversity. The results will serve as the basis for key genetic characteristics of populations of bees northern part of the area of ​​the Republic of Bashkortostan.
  069. Ilyasov R.A., Komissar A.D., Poskryakov A.V., Nikolenko A.G. Are Ukrainian bees a separate race? Materials of international conference Apimondia. Monpellier. 2009. P. 300-302.  

ARE UKRAINIAN BEES A SEPARATE RACE? Ilyasov R., Komissar* A., Poskryakov A., Nikolenko A. Russia, Institute of genetic and biochemistry , Ufa (Central Russia) * Ukraine, editor of magazine “The circle of beekeepers” Ukrainian bee • Disposed in Ukraine and South–Western regions of Russia. They also were the main in the forming of so named Far East population of Russian bees as they were bring to these lands by migrants from Ukraine in far 19 century. • Old scientific name of Ukrainian bees is Apis mellifera acervorum Scorikov • M.Engel find in 1999 that this name is uncorrect and propose new one Apis mellifera sossimai Engel 1999 THE NEAREST RELATIVES • It exists several hypothesis: • 1) “the southern branch of dark forest Northern European bees A.m. mellifera” • 2) “the eastern branch of Central European bees A.m.carnica”, • 3) “result of long term mixing of Russian and Middle European bees” • 4) they belong to Mediterranean race Apis mellifera macedonica Ruttner 1988. F.Ruttner hypothesis (1988) Picture 14.1 from the F. Ruttner book “Biogeography and taxonomy of honey bees”,1988, Springer-Verlag (Berlin, New York, London, Paris, Tokyo). • Names of countries and Black sea are our. • Apis mellifera macedonica are disposed in Northern Greece, Bulgaria, Southern Romania and ??? Ukraine. Migration of bee races to the north and east in the post Pleistocenic warm period 8-10 000 yeas ago. Arrow of migration Macedonica bees to modern territory of Ukraine is absent. Information • F.Ruttner hadn’t enough material from Ukraine to say, that Ukrainian bees are macedonical ones. • He give name macedonica not in the honour of small country Macedonia, but in the honour of famous Greece military leader Alexander Makedonian Wings venation • According DAMINO analyses, made in Czech Institute of apiculture in Dol by DR. Kvetoslav Chermak majority of samples of Ukrainian bees are the same as standard A.m.macedonica. • The bees from the best of these colonies were investigated in Russian genetical centre (city Ufa in Central Russia) by DR. Ilyasov R., Poskryakov A. and Nikolenko A. Fragment ND2 of mitochondrial DNK were investigated Results were inserted in GenBank • Ilyasov R.A., Komissar A.D., Baymiev A.K., Poskryakov A.V., Nikolenko A.G. Phylogenetics researches in Apis mellifera macedonica concluded from mitochondrial DNA sequence , • GenBank. 2006. - accession numbers DQ361088-DQ361090. And compare with another results from GenBank • Marino A., Mantovani B., Carpana E., Sabatini A.G., Lodesani M. ND2 and CO1 mitochondrial genes in Apis mellifera (             ) L.: a molecular approach to Mediterranean populations monitoring // GenBank, submitted numbers AY114484 - AY136625. 2002. • Arias M.C., Sheppard W.S. Molecular philogenetics of honey bee subspecies (Apis mellifera L.) inferred from mitochondrial DNA sequence // Molecular philogenetics and evolution. 1996. V. 5. - V. 3. P. - 557-566 • Franck P., Garnery L., Celebrano G., Solignac M. et al. Hybrid origins of the Italian honeybees, Apis mellifera ligustica and A.m.sicula // Mol. Ecol. 2000. V. 9. P. 907-923. This fact contributes to the opinion that: • Ukrainian bees are not the separate race but they are Ukrainian population of Macedonian bees. So the F.Ruttner hypothesis is correct. • Of course, long term adaptation in the climatic condition of Ukraine and selection by beekeepers at the last 200 years (one moment from the point of view of the race evolution) create the population with characteristics, which differ from the modern bees from the Northern Greece. • We (A.Komissar, 2005) proposed name Apis mellifera macedonica var. ukrainica for the Ukrainian bees. • The scientific name Apis mellifera sossimai Engel 1999 can be used for Ukrainian bees before new argument will be find. VERY INTERESTING AND UBSOLUTELY UNSCIENTIFIC FACT without explanation • Macedonian bees are disposed in Northern Greece, Bulgaria, Macedonia, Part of Serbia, Southern Romania, Ukraine and Western-Southern region of Russia. • Namely these countries (and only these) have orthodox religion . But race of bees lived on the earth long before forming of different religion. • So it is possible to create the unscientific hypothesis about mutual influence of aboriginal bees to the life of human population. • This hypothesis is unscientific absolutely as well as any religion is unscientific also. • Race of honeybees Apis mellifera macedonica can be named as race of bees for the peoples, who practice orthodox religion • See : Komissar A. Races of honey bees, human nations and religions. Proceeding of the 3-rd Europian Congress on Social Insects, St. Petersburg, Russia, 22-27 August 2005, P. 61.  

  068. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Генетическая характеристика локальной популяции пчел Альшеевского района Республики Башкортостан. Материалы Международной научно-практической конференции и Х зоологической конференции "Проблемы сохранения биологического разнообразия и использования биологических ресурсов". Минск. 2009. Ч. 1. С. 127-130.  

В работе были взяты локальные популяции пчел трех пасек Альшеевского района республики Башкортостан, локальная популяция пчел пасеки Красновишерского района Пермского края, ранее определенная как популяция A.m.mellifera по результатам анализа локуса COI-COII мтДНК и двух микросателлитных локусов ap243 и 4a110 (Ильясов с соавт., 2006), и локальная популяция пчел пасеки Красноуфимского района Свердловской области, ранее определенная как популяция гибридного происхождения по результатам анализа локуса COI-COII мтДНК (Ильясов с соавт., 2008).
На основе анализа полиморфизма локуса COI-COII мтДНК и микросателлитных локусов ap243, 4a110, a24, a8, a43, a113, ap049 яДНК были рассчитаны генетические расстояния Nei между локальными популяциями. Генетические расстояния были рассчитаны отдельно по микросателлитным локусам и отдельно с использованием локусов ядерной и митохондриальной ДНК. Генетические расстояния были рассчитаны как для каждой пасеки отдельно, так и для локальной популяции района, включающей все пасеки района. Генетические расстояния были рассчитаны отдельно по локусам яДНК и совместно с локусом мтДНК для того, чтобы показать вклад отцовского и материнского генома.
Генетические расстояния по микросателлитным локусам изменяются от 0,069 между пасеками Антипина Н.Т. д. Поршакова Красновишерского района Пермского края и Ватолина Г.А. д. Татарский Турыш Красноуфимского района Свердловской области до 0,397 между пасеками Юсуповой Р.А. д. Никифарово Альшеевского района республики Башкортостан и Селезнева Б.П. п. Раевка Альшеевского района республики Башкортостан. Генетические расстояния по микросателлитным локусам и локусу COI-COII мтДНК изменяются от 0,135 между пасеками Селезнева Б.П. п. Раевка Альшеевского района республики Башкортостан и Ватолина Г.А. д. Татарский Турыш Красноуфимского района Свердловской области до 0,613 между пасеками Юсуповой Р.А. д. Никифарово Альшеевского района республики Башкортостан и Селезнева Б.П. п. Раевка Альшеевского района республики Башкортостан.
На основе полученных генетических расстояний Nei (1987) была построена дендрограмма, отражающая генетические взаимоотношения локальных популяций, где пасека Ватолина Г.А. д. Татарский Турыш Красноуфимского района Свердловской области объединяется с пасекой Селезнева Б.П. п. Раевка Альшеевского района республики Башкортостан, а пасека Юсуповой Р.А. д. Никифарово Альшеевского района республики Башкортостан объединяется с пасекой Антипина Н.Т. д. Поршакова Красновишерского района Пермского края. Пасека Пискарева М.П. п. Раевка Альшеевского района республики Башкортостан примыкает на отдаленном расстоянии к последней группе. На дендрограмме, где рассматривается отдельно локальная популяция пчел Альшеевского района республики Башкортостан построенной только по микросателлитным локусам видно, что локальная популяция пчел Красновишерского района Пермского края и локальная популяция пчел Красноуфимского района Свердловской области объединяются в одну группу, тогда как локальная популяция пчел Альшеевского района республики Башкортостан располагается отдельно. В случае же включения локусов мтДНК локальная популяция пчел Альшеевского района республики Башкортостан группируется вместе с локальные популяцией пчел Красновишерского района Пермского края. Такое расположение можно объяснить тем, что в локальной популяции пчел Альшеевского района республики Башкортостан гибридизация шла в большей степени по отцовской линии, чем по материнской.
В альшеевской локальной популяции пчел Ho наблюдаемая гетерозиготность локальные популяции по данным анализа микросателлитных локусов 0,449 меньше Hs средней ожидаемой гетерозиготности субпопуляции 0,467 и Ht ожидаемой гетерозиготности локальные популяции 0,561, что говорит о незначительном дефиците гетерозигот.
Fis коэффициент инбридинга особей в субпопуляциях имеет близкое к 0 положительное значение 0,006, что говорит о незначительности отклонения от равновесия по Харди Вайнбергу. Fit коэффициент инбридинга субпопуляций также положителен 0,244, что говорит о некоторой доле инбридинга на уровне всей локальные популяции. Возможно, что наблюдается эффект Валунда, где для подразделенной локальные популяции наблюдается инбридинг на локальные популяционном уровне.
Значение Fst для всех микросателлитных локусов 0,244. Это говорит о подразделенности популяции пчел Альшеевского района, что дает популяции большую устойчивость. Такое значение Fst отражает 24% различий между пасеками Альшеевского р-на в среднем.
Наибольший уровень генного разнообразия по локусам ap243 и 4a110 со значениями 0,607 и 0,545 соответственно наблюдается в популяции пасеки Антипина Н.Т. д. Поршакова Красновишерского района Пермского края; по локусу a24 со значением 0,675 - в популяции пасеки Юсуповой Р.А. д. Никифарово Альшеевского района республики Башкортостан; по локусу a8 со значением 0,625 - в популяции пасеки Ватолина Г.А. д. Татарский Турыш Красноуфимского района Свердловской области; по локусу a43 со значением 0,600- в популяциях пасек Юсуповой Р.А. д. Никифарово и Пискарева М.П. п. Раевка Альшеевского района республики Башкортостан; по локусу a113 со значением 0,600 - в популяции пасеки Пискарева М.П. п. Раевка Альшеевского района республики Башкортостан, а в остальных популяциях наблюдалось нулевое значение, за исключением пасеки Юсуповой Р.А. д. Никифарово Альшеевского района республики Башкортостан; по локусу ap049 со значением 0,550 - в популяции пасеки Юсуповой Р.А. д. Никифарово Альшеевского района республики Башкортостан.
Таким образом, по разным локусам наблюдаются разные результаты, что говорит о независимом наследовании и разном уровне отбора локусов. Наибольший уровень генного разнообразия говорит о наибольшем биоразнообразии по данному локусу и наибольшей устойчивости. Кроме того, наибольший уровень генного разнообразия свидетельствует и об устойчивом поддержании биоразнообразия на высоком уровне, что может быть вызвано аутбридингом. По всем локусам наибольшие уровни генного разнообразия 0,504 и 0,525 наблюдаются в популяциях пасек Юсуповой Р.А. д. Никифарово и Пискарева М.П. п. Раевка Альшеевского района республики Башкортостан. По районам наибольшие уровни генного разнообразия со значениями 0,560 и 0,414 наблюдается в популяциях пчел Альшеевского района республики Башкортостан и Красноуфимского района Свердловской области, что может быть вызвано процессом гибридизации и разнообразящим отбором в дальнейшем.
In this paper were taken three local populations of bees apiaries Alsheevsky district of the republic of Bashkortostan, the local population of bees apiary Krasnovishersky district of the Perm region, previously defined as a population Ammellifera on the analysis of the locus of mtDNA COI-COII two microsatellite loci and ap243 4a110 (Ilyasov et al., 2006), and the local population of bees apiary Krasnoufimsky district of Sverdlovsk region, previously defined as a population of hybrid origin from the analysis of the locus of mtDNA COI-COII (Ilyasov et al., 2008).
Based on the analysis of polymorphism locus COI-COII mtDNA and microsatellite loci ap243, 4a110, a24, a8, a43, a113, ap049 nuclear DNA were calculated Nei genetic distances between the local populations. Genetic distances were calculated separately for microsatellite loci and loci separately using nuclear and mitochondrial DNA. Genetic distances were calculated for each apiary separately and for the local population of the district, which includes all of the apiary area. Genetic distances were calculated separately for the loci nDNA together and the locus of mtDNA to show the contribution of maternal and paternal genome.
Genetic distances of microsatellite loci vary from between 0,069 apiaries Antipina NT d. Porshakova Krasnovishersky district of the Perm region and Vatolina GA d. Turishev Krasnoufimsky Tatar district of Sverdlovsk region to between 0,397 apiaries Yusupova RA d. Nikifarovo Alsheevsky district of the republic of Bashkortostan and Seleznev BP n. Raevka Alsheevsky district of the republic of Bashkortostan. Genetic distances of microsatellite loci and the locus of mtDNA COI-COII vary from between 0,135 apiaries Selezneva BP n. Raevka Alsheevsky district of the republic of Bashkortostan and Vatolina GA d. Turishev Krasnoufimsky Tatar district of Sverdlovsk region to between 0,613 apiaries Yusupova RA d. Nikifarovo Alsheevsky district of the republic of Bashkortostan and Seleznev BP n. Raevka Alsheevsky district of the republic of Bashkortostan.
On the basis of genetic distances Nei (1987) was constructed dendrogram showing the genetic relationships of local populations where the apiary Vatolina GA d. Turishev Krasnoufimsky Tatar district of Sverdlovsk region is combined with the BP apiary Selezneva n. Raevka Alsheevsky district of the republic of Bashkortostan, and apiary Yusupova RA d. Nikifarovo Alsheevsky district of the republic of Bashkortostan is combined with the apiary Antipina NT d. Porshakova Krasnovishersky district of the Perm region. Apiary Piskareva MP n. Raevka Alsheevsky district adjoins the Republic of Bashkortostan in the remote distance to the last group. In the dendrogram, where the local population is considered separately bees Alsheevsky district of the republic of Bashkortostan built only microsatellite loci can be seen that the local bee population Krasnovishersky district of the Perm region and the local population of bees Krasnoufimsky district of Sverdlovsk region together in one group, while the local population Bee Alsheevsky district of the republic of Bashkortostan located separately. In the case of inclusion of mtDNA loci local bee population Alsheevsky district of the republic of Bashkortostan is grouped together with the local bee population Krasnovishersky district of the Perm region. This arrangement may be explained by the fact that the local bee population Alsheevsky district of the republic of Bashkortostan hybridization was largely paternal than maternal.
In Alsheevsky local bee population Ho observed heterozygosity local populations by analysis of microsatellite loci 0.449 less than the average expected heterozygosity Hs subpopulation 0.467 and Ht expected heterozygosity local populations 0.561, indicating a slight deficit of heterozygotes.
Fis the inbreeding coefficient of individuals in subpopulations has close to 0,006 0 positive, indicating that minor deviations from Hardy Weinberg equilibrium. Fit the inbreeding coefficient is also positive subpopulations of 0.244, indicating that some fraction of inbreeding at the level of the entire local populations. It is possible that the effect observed Valunda, where local populations subdivided inbreeding observed in the local population level.
Fst value for all microsatellite loci 0.244. This suggests subdivision bee population Alsheevsky area, giving a population greater stability. This value Fst represents 24% difference between apiaries Alsheevsky district average.
The highest level of genetic diversity at loci ap243 4a110 and with values ​​0.607 and 0.545 respectively, observed in the population apiary Antipina NT d. Porshakova Krasnovishersky district of the Perm region; locus a24 with the value 0.675 - in the population apiary Yusupova RA d. Nikifarovo Alsheevsky district of Bashkortostan Republic; locus a8 with a value of 0.625 - in the population apiary Vatolina GA d. Turishev Krasnoufimsky Tatar district of Sverdlovsk region; locus a43 with a value 0,600- populations apiaries Yusupova RA d. Nikifarovo and Piskareva MP n. Raevka Alsheevsky district of the republic of Bashkortostan; locus a113 with a value of 0.600 - in the population apiary Piskareva MP n. Raevka Alsheevsky district of the republic of Bashkortostan, as observed in other populations of zero, with the exception of the apiary Yusupova RA d. Nikifarovo Alsheevsky district of Bashkortostan Republic; locus ap049 with the value 0.550 - in the population apiary Yusupova RA d. Nikifarovo Alsheevsky district of the republic of Bashkortostan.
Thus, according to various loci observed different results, suggesting independent inheritance and different levels of selection loci. The highest level of genetic diversity suggests the greatest biodiversity on the locus and the greatest stability. In addition, the highest level of genetic diversity and demonstrates the sustainable maintenance of a high level of biodiversity that can be caused by outbreeding. For all loci highest levels of genetic diversity 0.504 and 0.525 observed in populations of apiaries Yusupova RA d. Nikifarovo and Piskareva MP n. Raevka Alsheevsky district of the republic of Bashkortostan. In areas of the highest levels of genetic diversity with the values ​​of 0.560 and 0.414 observed in populations of bees Alsheevsky district of the republic of Bashkortostan and Krasnoufimsky district of Sverdlovsk region, which may be caused by the process of hybridization and diversifying selection in the future.
  067. Ильясов Р.А., Николенко А.Г., Поскряков А.В. Новые представления о филогенетике пчелы вида Apis mellifera L. Материалы Международной научно-практической конференции "Экология, эволюция и систематика животных". Рязань. 2009. С. 315-316.  

В работе были использованы пчелы подвида A.m.mellifera из бурзянской и татышлинской популяций Республики Башкортостан и вишерской и южно-прикамской популяций Пермского края, которые были ранее выделены нами на основе изучения полиморфизма межгенного локуса COI-COII мтДНК (Ильясов с соавт., 2006). Также были использованы пчелы из украинской популяции с пасеки А.Д.Комиссара под Киевом. Для проведения секвенционного анализа было взято по три образца из каждой популяции.
При сравнении нуклеотидной последовательности фрагмента гена ND2 мтДНК уральских и украинских пчел с последовательностью бурзянской бортевой пчелы (DQ181611), взятой в качестве референсной, всего наблюдались нуклеотидные замены в 12 позициях. Между всеми уральскими пчелами наблюдалось 5 сайтов замен, где замена в позиции 536 Т на С в двух пчелах DQ181614 и DQ181618 приводила к замене в позиции 12 аминокислотной последовательности Ile на Thr. Украинские пчелы различались от референсной последовательности сайтами замен в 8 позициях, где замена в позиции 987 являлась трансверсией. Между собой украинские пчелы практически не различались – наблюдалась всего одна замена нуклеотидной последовательности фрагмента гена ND2 мтДНК в позиции 1099, которая не приводит к заменам в аминокислотной последовательности.
На основе сравнительного анализа нуклеотидной последовательности фрагмента гена ND2 мтДНК пчел популяций A.m.mellifera на Урале с использованием компьютерной программы MEGA 3.1 методом кластеризации ближайшего соседа была построена дендрограмма. На дендрограмме наблюдался низкий уровень дифференциации представителей разных популяций A.m.mellifera на Урале. Однако можно отметить, что все три представителя вишерской популяции (DQ181617-19), а также один представитель южно-прикамской популяции (DQ181621) все же в некоторой степени отличаются от всех представителей других популяций Урала, хотя эти различия очень незначительны. Такие различия представителей вишерской популяции, возможно, являются результатом длительной изоляции в условиях крайнего севера видового ареала. Известно, что семьи пчелы из этой популяции  неоднократно завозились на пасеки юга Пермского края, что и, возможно, объясняло группировку вместе с пчелами вишерской популяции представителя южно-прикамской популяции (DQ181621). Большие различия наблюдались между представителями уральских и украинских популяций, что обусловлено, несомненно, их принадлежность к разным подвидам - A.m.mellifera и A.m.macedonica, соответственно.
Для определения филогенетического паттерна вида A.mellifera и выявления положение в нем уральских и украинских пчел было проведено сравнение нуклеотидной последовательности фрагмента гена ND2 мтДНК просеквенированных нами пчел с последовательностями пчел разных других подвидов A.mellifera, просеквенированных M.C.Arias, W.S.Sheppard (1996), W.S.Sheppard, M.D.Meixner (2003). Нуклеотидная последовательность фрагмента гена ND2 мтДНК подвида пчелы A.m.anatoliaca была взята в качестве референсной последовательности и использована для сравнения с последовательностями всех образцов пчел. При сравнении секвенсов всех образцов пчел наблюдались нуклеотидные замены в 28 позициях. Из всех замен 8 относились к трансверсиям, а 20 – к транзициям, что вполне укладывалось в рамки законов молекулярной эволюции.
На основе сравнения нуклеотидных последовательностей с использованием программы MEGA 3.1 и метода кластеризации ближайшего соседа была построена дендрограмма генетических отношений подвидов A.mellifera с видами Apis cerana и Mellipona bicolor, где последние были взяты в качестве внешней группы. На дендрограмме наблюдалась группировка образцов пчел на четыре эволюционные ветви, что не противоречило результатам F.Ruttner (1988). Однако состав этих ветвей отличался от представленного F.Ruttner (1988) и был в некоторой степени схож с представленными в работе M.C.Arias, W.S.Sheppard (1996). Однако четыре эволюционные ветви были все же названы A, M, C и O сходно с F.Ruttner (1988).
Эволюционная ветвь А объединяла большинство представителей африканских подвидов пчел. Эта эволюционная ветвь подразделялась на две группы, одна из которых объединяла A.m.sahariensis (U35762) и A.m.inermissa (U35751) из Марокко, A.m.sicula (U35765) с Сицилии и A.m.iberica (U35750) из Португалии. Другая группа объединяла большинство южно-африканских подвидов пчел как A.m.adansonii из Нигерии (U35743), A.m.scutellata (U35764) и A.m.capensis (U35747) из ЮАР, A.m.monticola (U35761) из Кении и африканизированных пчел из Бразилии (U35745-46). Кроме того, выделялась еще одна небольшая третья группа африканских пчел, объединяющая представителей подвидов A.m.scutellata (U35763) из Кении и A.m.adansonii (U35744) из Сенегала, то есть на территории, огибающей пустыню Сахара.
Эволюционная ветвь О была очень малочисленной и объединяла представителей подвидов A.m.meda (U35756) и A.m.syriaca (AY618920) из Сирии и A.m.lamarckii (U35753) из Египта.
Эволюционная ветвь М объединяла в основном всех представителей A.m.mellifera уральских (DQ181611-22) и европейских популяций из Швейцарии (AY114495), Франции (U35758), Испании (U35759) и Норвегии (U35760). Однако в эту группу также вошли по два представителя подвидов A.m.sicula (AY114493-94) с Сицилии и A.m.ligustica (U35752 и AY114490) из Италии, которые попали в эту группу, возможно, благодаря первоначальной гибридизации с завезенными туда A.m.mellifera. По нашим данным только A.m.mellifera является единственным представителем эволюционной ветви М.
Эволюционная ветвь С была наиболее многочисленной как по числу подвидов, так и по числу образцов и объединяла подвиды пчел Средиземноморья, Ближнего Востока и Кавказа - A.m.ligustica  из Италии, A.m.carnica из Германии, Австрии и Словении, образцы A.m.macedonica из Греции и Украины с пасеки А.Д.Комиссара проанализированные нами, A.m.cecropia из Греции, A.m.sicula с Сицилии, A.m.cypria с Кипра, A.m.adami с Крита, A.m.caucasica с Кавказа, A.m.meda из Сирии, A.m.anatoliaca из Турции, A.m.syriaca из Сирии и A.m.pomonella с Тянь-Шаня. Однако по составу подвидов этой эволюционной ветви наблюдались различия с F.Ruttner et al. (1988), которые относили подвиды A.m.caucasica, A.m.adami, A.m.cypria, A.m.meda, A.m.anatoliaca и A.m.syriaca к эволюционной ветви О.
Проведенное исследование показало генетическое родство уральских и западноевропейских популяций A.m.mellifera. Возможно, что подвид A.m.mellifera является единственным представителем внутривидовой эволюционной ветви М, в которую, таким образом, не следует включать не только африканские подвиды Apis mellifera sahariensis и Apis mellifera intermissa, но и испанский подвид Apis mellifera iberica, что противоречит гипотезе F.Ruttner (1988). Показано, что предковой формой вида Apis mellifera L., могли быть пчелы эволюционной ветви С, а не О, как считал ранее F.Ruttner (1988). Результаты анализа украинских пчел, подтвердили их принадлежность к подвиду A.m.macedonica. Было подтверждено, что подвиды A.mellifera подразделяются на 4 эволюционные ветви, а не 3, как считали ранее.
We used bee subspecies of Ammellifera Burzyan tatyshlinskoy populations and the Republic of Bashkortostan and Visherskaya Kama region and southern populations of the Perm region, which had previously been allocated on the basis of our study of polymorphism of the intergenic locus COI-COII mtDNA (Ilyasov et al., 2006). Bees were also used from the Ukrainian population from the apiary A.D.Komissara near Kiev. To perform the analysis were taken sekventsionnogo Three samples of each population.
When comparing the nucleotide sequence of the gene fragment ND2 mtDNA Ural and Ukrainian bees sequence Burzyan wild-hive bee (DQ181611), taken as a reference, the entire nucleotide substitutions were observed at 12 positions. Between all the Ural bees observed 5 sites replacements where the replacement at position 536 T to C in two bees DQ181614 and DQ181618 leads to the substitution at position 12 in the amino acid sequence Ile Thr. Ukrainian bees differ from the reference sequence sites substitutions in 8 positions where substitution at position 987 was transversions. Between a Ukrainian bees practically identical - there was only one replacement of the nucleotide sequence of a gene fragment ND2 mtDNA positions in 1099, which does not lead to substitutions in the amino acid sequence.
On the basis of a comparative analysis of the nucleotide sequence of a gene fragment ND2 mtDNA bee populations in the Urals Ammellifera using a computer program MEGA 3.1 by nearest neighbor clustering dendrogram was constructed. In the dendrogram observed low level of differentiation of representatives of different populations Ammellifera the Urals. However, it should be noted that all three members of the population Visherskaya (DQ181617-19), as well as one representative of the population of South-Kama region (DQ181621) is still somewhat different from all other representatives of the Urals populations, although these differences are very minor. Such differences representatives Visherskaya populations are probably a result of long-term isolation in the Far North of the species range. It is known that the family of bees this population often imported apiary on the south of the Perm region, and that may explain the grouping together with bees Visherskaya population representative of the population of the South-Kama region (DQ181621). Large differences were observed between the Ural and Ukrainian population, due, no doubt, they belong to different subspecies - Ammellifera and Ammacedonica, respectively.
To determine the phylogenetic species A.mellifera pattern and identify its position in the Ural and Ukrainian bees were compared the nucleotide sequence of the gene fragment sequenced mtDNA ND2 our bees with different sequences of other subspecies of bees A.mellifera, sequenced MCArias, WSSheppard (1996), WS Sheppard, MDMeixner (2003). The nucleotide sequence of a gene fragment ND2 mtDNA bee subspecies Amanatoliaca was taken as a reference sequence, and used for comparison with the sequences of all the samples of bees. When comparing all samples Sequence bees observed nucleotide substitutions in 28 positions. Of the 8 substitutions treated transversions and 20 - to the transitions that fits into the framework of the laws of molecular evolution.
Based on a comparison of the nucleotide sequences using the program MEGA 3.1 and the nearest neighbor clustering method was constructed dendrogram of genetic relationship subspecies A.mellifera overlooking Apis cerana and Mellipona bicolor, where the latter have been taken as an outgroup. In the observed dendrogram grouping samples of bees into four evolutionary branch that does not contradict the results of F.Ruttner (1988). However, the composition of these branches differ from the F.Ruttner (1988) and was somewhat similar to that shown in MCArias, WSSheppard (1996). However, four evolutionary branches were still named A, M, C and O is similar to F.Ruttner (1988).
Evolutionary branch A united the majority of the African subspecies of bees. This evolutionary branch was divided into two groups, one of which is united Amsahariensis (U35762) and Aminermissa (U35751) from Morocco, Amsicula (U35765) with Sicily and Amiberica (U35750) from Portugal. Another group unites the majority of the South African subspecies of bees as a Amadansonii Nigeria (U35743), Amscutellata (U35764) and Amcapensis (U35747) from South Africa, Ammonticola (U35761) from Kenya and Africanized bees in Brazil (U35745-46). Furthermore, stood another small third group of African bees, uniting representatives of subspecies Amscutellata (U35763) from Kenya and Amadansonii (U35744) from Senegal, that is the territory of the envelope Sahara Desert.
On the evolutionary branch it is very small and has united representatives of subspecies Ammeda (U35756) and Amsyriaca (AY618920) from Syria and Amlamarckii (U35753) from Egypt.
The evolutionary branch of M united mainly of representatives of the Ural Ammellifera (DQ181611-22) and European populations from Switzerland (AY114495), France (U35758), Spain (U35759) and Norway (U35760). However, this group also includes two representatives subspecies Amsicula (AY114493-94) from Sicily and Amligustica (U35752 and AY114490) from Italy, who are in this group, probably due to the initial hybridization with importations to Ammellifera. According to our data only Ammellifera the sole representative of the lineage M.
With evolutionary branch was the most numerous in both the number of subspecies, and the number of samples and bee subspecies united Mediterranean, the Middle East and the Caucasus - Amligustica from Italy, Amcarnica from Germany, Austria and Slovenia, Ammacedonica samples from Greece and Ukraine in the apiary A.D.Komissara analyzed by us, Amcecropia from Greece, Amsicula from Sicily, Amcypria Cyprus, Amadami Crete, Amcaucasica the Caucasus, Ammeda Syria, Amanatoliaca from Turkey, Amsyriaca from Syria and Ampomonella with the Tien Shan. However, the composition of the sub-species evolutionary branch observed differences F.Ruttner et al. (1988), which refers subspecies Amcaucasica, Amadami, Amcypria, Ammeda, Amanatoliaca and Amsyriaca to evolutionary branch O.
The study showed the genetic relationship of the Urals and Western European populations Ammellifera. Perhaps Ammellifera subspecies is the only representative of intraspecific evolutionary branches M, which thus should not be included not only African subspecies Apis mellifera sahariensis and Apis mellifera intermissa, but Spanish subspecies Apis mellifera iberica, which contradicts the hypothesis F.Ruttner ( 1988). It is shown that the ancestral form of the type Apis mellifera L., could be evolutionary branch with bees, and not, as previously thought F.Ruttner (1988). The results of the analysis of Ukrainian bees, have confirmed that they belong to the subspecies Ammacedonica. It was confirmed that the subspecies A.mellifera divided into 4 evolutionary branches, not 3, as previously thought.
  066. Колбина Л.М., Непейвода С.Н., Ильясов Р.А., Николенко А.Г., Поскряков А.В. Генетический анализ популяции пчел Западного Предуралья и Республики Башкортостан. Материалы Международной научно-практической конференции "Зоотехническая наука на удмуртской земле. Состояние и перспективы". Ижевск. 2009. С.49-55.  

Рассмотрены две популяции пчёл Западного Предуралья и Республики Башкортостан. По результатам анализа ядерной и митохондриальной ДНК на территории Западного Предуралья распространена генетически подразделенная популяция пчёл среднерусской породы, частично гибридизированная с подвидами из южных регионов. Проведен сравнительный анализ популяций пчел Западного Предуралья с популяцией пчел среднерусской расы A.m.mellifera Бурзянского района и гибридной популяцией Иглинского района Республики Башкортостан. В исследованиях использовался анализ межгенного локуса COI-COII мтДНК и микросателлитный локус 4а110 яДНК. По результатам исследований выявлены частоты встречаемости двух видов аллелей микросателлитного локуса 4а110 ядерной ДНК и межгенного локуса COI-COII митохондриальной ДНК. Исходя из вышеприведенной частоты, легко вычислить ожидаемую встречаемость генотипов микросателлитного локуса 4а110 ядерной ДНК при условии случайного смешивания. Однако исследования показали, что реальная картина частот встречаемости генотипов отличается от ожидаемой. В некоторых случаях очень значительно, особенно у Глазовской и Камбарской популяций. В то же время частота встречаемости генотипов Шарканской популяции практически соответствует ожидаемой. Частота встречаемости генотипов межгенного локуса COI-COII митохондриальной ДНК равна частоте встречаемости аллелей. Для любого локуса генетическое разнообразие является вероятностью того, что две аллели, случайным образом выбранных в популяции, будут отличаться друг от друга. Если генное разнообразие микросателлитного локуса 4а110 ядерной ДНК большое у всех изученных популяций, то генное разнообразие межгенного локуса COI-COII митохондриальной ДНК в большинстве случаев невысоко, в нем лидирует Бурзянская популяция, чуть меньшее разнообразие в Шарканской и Завьяловской популяции, а в Глазовской и Мож- гинской популяции все изученные образцы по межгенному локусу COI-COII митохондриальной ДНК принадлежат к одному генотипу. В дальнейшем были рассчитаны коэффициенты генетической дифференциации Fst для уральских популяций совместно по анализу микросателлитного локуса 4а110 ядерной ДНК и межгенного локуса COI-COII митохондриальной ДНК. Значение коэффициента дифференциации Fst колеблется от 0,011 до 0,422, что в большинстве случаев позволяет утверждать о наличии статистически значимой дифференциации популяций пчел. Генетические расстояния, рассчитанные с помощью анализа частот аллелей межгенного локуса COI-COII митохондриальной ДНК, были в пределах от 0,000 до 0,966. В отличие от результатов, полученных с помощью изучения микросателлитного локуса 4а110 ядерной ДНК, эти данные говорят о гораздо большей дистанции между популяциями пчел. Особенно далеко отстоит от других Завьяловская популяция, пределы генетических расстояний между ней и остальными популяциями колеблются в пределах от 0,133 до 1,151, что демонстрирует очень значительные различия в происхождении этих популяций. При графическом отображении генетической дифференциации популяций на основе полученных генетических расстояний (D) Nei микросателлитного локуса 4а110 ядерной ДНК легко заметить, что Глазовская популяция наиболее удалена от других популяций, тогда как между остальными не обнаружено статистически значимой генетической дифференциации. При графическом отображении генетической дифференциации популяций на основе полученных генетических расстояний (D) Nei межгенного локуса COI-COI1 митохондриальной ДНК наблюдается принципиально иная картина. Четко обособлена от остальных популяций пчел Завьяловская. Кроме того, выделяются две четкие группы популяций, в одну входят Иглинская и Шарканская популяции, а во вторую Бурзянская, Камбарская, Мало-Пургинская, Глазовская и Можгинская популяции. Внутри двух выделенных групп популяций не удалось обнаружить статистически значимую генетическую дифференциацию. При графическом отображении генетической дифференциации популяций на основе совместного анализа генетических расстояний (D) Nei как икросателлитного локуса 4аП0 ядерной ДНК, так и межг енного локуса COI-COII митохондриальной ДНК наблюдается картина, схожая с предыдущей. Четко обособлена Завьяловская популяция пчел, остальные популяции разделяются на две достоверно отличающиеся друг от друга группы, внутри которых не наблюдается статистически значимой генетической дифференциации. Таким образом, по результатам анализа ядерной и митохондриальной ДНК на территории Западного Предуралья наблюдается генетически подразделенная популяция пчел среднерусской расы, частично гибридизированная с подвидами из южных регионов. Очень небольшой объем выборки позволяет делать только предварительные выводы.
We examined two populations of bees and of the West Urals Bashkortostan. According to the analysis of nuclear and mitochondrial DNA in the West Urals common genetic subdivision Central Russian breed of bees population, partly hybridized a subspecies of the southern regions. A comparative analysis of bee populations West Ural region with a population of bees of Central race Ammellifera Burzyansky district and hybrid populations iglinsky district Republic of Bashkortostan. The study used the analysis of intergenic locus COI-COII mtDNA and nuclear DNA microsatellite loci 4a110. According to the research revealed the frequency of occurrence two kinds of alleles of microsatellite loci 4a110 nuclear DNA intergenic locus COI-COII mitochondrial DNA. Based on the above frequency, it is easy to calculate the expected genotypes of microsatellite loci 4a110 Nuclear DNA provided accidental mixing. However, studies have shown that the real picture of the frequency of occurrence of genotypes It is different from the expected. In some cases, very significant, especially in the Glazov and Kambarka populations. In the same time frequency of genotypes Sharkan population almost It corresponds to the expected. The frequency of genotypes intergenic locus COI-COII equal to the frequency of mitochondrial DNA alleles. For each locus, genetic diversity is likely that the two alleles in a randomly selected population will differ from each other. If genetic diversity microsatellite loci 4a110 nuclear DNA in all large populations studied, the genetic diversity intergenic locus COI-COII mtDNA in most cases, is low, it leads Burzyan population slightly smaller variety in Sharkan and Zavyalovsky population, and in the Glazov and one can ginskiT population of all the studied samples of intergenic locus COI-COII mitochondrial DNA belong to the same genotype. In the future, genetic factors were calculated Fst differentiation for the Ural population together Analysis microsatellite loci 4a110 nuclear DNA and the intergenic locus COI-COII mitochondrial DNA. The coefficient Fst differentiation ranges from 0.011 to 0.422, in most cases, suggests the presence of a statistically significant differentiation of bee populations. Genetic distances calculated using frequency analysis alleles intergenic locus COI-COII mitochondrial DNA, They ranged from 0.000 to 0.966. In contrast to the results obtained by studying nuclear microsatellite loci 4a110 DNA, these data suggest a much greater distance between populations bees. Especially far from other Zavyalovsky population, limits genetic distances between it and the rest populations ranged from 0.133 to 1.151, which demonstrates very significant differences in the origin of these populations. In the graphical display of genetic differentiation population based on genetic distances obtained (D) Nei microsatellite loci 4a110 nuclear DNA is easy to see that Glazovskaya population is furthest from the other populations, then both among the other found no statistically significant genetic differentiation. In the graphical display of genetic differentiation population based on genetic distances obtained (D) Nei intergenic locus COI-COI1 mitochondrial DNA is observed radically different picture. Clearly separated from the rest of the population Zavyalovsky bees. Furthermore, it identifies two distinct groups populations, one includes Iglinskiy and Sharkan population and the second Burzyan, Kambarka, Little Purginskaya, Glazovskaya and Mozhginsky population. Within two selected population groups could not find a statistically significant genetic differentiation. In the graphical display of genetic differentiation populations on the basis of a joint analysis of genetic distances (D) Nei like ikrosatellitnogo locus 4aP0 nuclear DNA and the inter-tary locus COI-COII mitochondrial DNA is observed picture, similar to the previous one. Clearly separated Zavyalovsky population bees, other populations are divided into two significantly different from each other group, which is not observed in statistically significant genetic differentiation. Thus, according to the analysis of nuclear and mitochondrial DNA in the West Urals been genetically subdivided population of bees of Central race, partly hybridized with a subspecies of the southern regions. Highly small sample size allows only preliminary findings.
  065. Kolbina L.M., Nepeivoda S.N., Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Comparing the methods of race determination bee-colonies under global crossbreeding of bees. Materials of international conference "XLVI Naukowa konferencja pszczelarska". Pulawy. 2009. P. 37-38.

In our research the sample of 63 bee-families of 11 apiaries of 6 regions of Udmurtia Repablic was used. In this research we used morphometric and genetic methods. Genetic research was carried out in common with institute of biochemistry and genetics of Ufa scientific center Russian Academy of Sciences. The basis of genetic analysis was the polymorphism of intergenic locus COI-COII of different races of bees (table 1).
The results of both methods coincided more than by 66% in Mozhginskiy region, in diametrical opposition with Sharkanskiy region. This allows to choose confidently only the one population of A.m. silvanium that habits in Mozhginskiy region, all other bees were strongly crossbreeded.
Besides all its advantages, genetic method has serious weakness. The native race of the bees of Udmurtia Republic is Apis mellifera mellifera, and brought bee-families of other races were the small part in general bees of Udmurtia Republic. In result the most part of crossbreeding of bee-families was from the male line, which genetic method can not consider. On other hand, high variability of morphological characteristics, that appear as results of global crossbreeding, leaded to the effect that some of hybrid bee-families have figure of A.m. mellifera race. Therefore, reliable results can be obtained only by using both morphological and genetic methods of analysis.
  064. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Investigations of population Apis mellifera mellifera L. from Burzyan district of Bashkortostan on Southern Urals. Materials of international conference "XLVI Naukowa konferencja pszczelarska". Pulawy. 2009. P. 41-42.

Our earlier researches was shown that bashkir bees (bees from Bashkortostan republic of Russia) on taxonomy behaved to the subspecies of A.m.mellifera. Originally one unique place where conservation clean strains of this bee considered a small region on the south of Bashkortostan in national park “Shulgan-Tash”. The task of our research is the study bees population on south part of natural area of bashkir bees.
Bees were selected from 5 places: village Starosubkhangulovo, village Novomusyatovo, village Irgyzly of Burzyanskii district, village Krutoi log of Аbzelylovskii district, village Syuren Кugarchynskii district of Bashkortostan. In research were used: locus COI-COII mtDNA, 4 microsatellite locuses ap243, 4a110, a8, a43 of nuclear DNA. We calculated frequencies of alleles of every locuses. Frequencies of combination PQQ (marker of A.m.mellifera) of intergenic locus COI-COII mtDNA in all bees populations were with frequency 1.0, while in Syuren there haven’t it. For receiption of information about distributing of southern bashkir bee population is necessary to get frequencies of all alleles and genetic distances between local populations.
Maximal distances is observed between populations Syuren and Krutoi log. Minimal distances – between populations Krutoi log and Novomusyatovo. Such grouping agreed both geographical location and genetic composition of these population. In cluster analysis by neighbour joining method population of Syuren disposed apart from all because hybrid colonies of bees are represented here mainly. Picture of cluster analysis can reflect some degrees the levels of migrations between populations where most close located population will be closely-related genetically also. Thus, our conducted researches allow to make conclusion that natural area of Burzyan population (bees population in Burzyanskii district) of bashkir bees A.m.mellifera, possibly has expansion to east direction to Аbzelylovskii district, while to a south to Кugarchynskii district it hasn’t expansion.
  063. Шареева З.В., Ильясов Р.А., Кутлин Н.Г., Поскряков А.В., Николенко А.Г. Пчела подвида Apis mellifera mellifera L. на Cевере республики Башкортостан // Ученые записки Казанской государственной академии ветеринарной медицины им. Н. Э. Баумана. Серия. Естественные науки. 2008. Т. 195. С. 245-249.

Проблема гибридизации темной лесной пчелы с южными подвидами и сохранение генофонда среднерусских пчел Apis mellifera mellifera L. является основной в развитии пчеловодства России уже более полувека. В настоящее время для их решения применяются как классические (анализ фенотипических признаков – экстерьерные, морфологические, хозяйственно-полезные, поведенческие) (надо все убрать, т.к. уже есть в начале), так и современные молекулярно-генетические методы идентификации расовой принадлежности медоносных пчел, что значительно повысило эффективность анализов при высоком количестве гибридных семей. Исследуемые нами районы также попали под массовый эксперимент по гибридизации, который преследовал цель – улучшение хо-зяйственнополезных  признаков местных пчел. Полученные нами результаты позволяют утверждать , что в данных популяциях произошел процесс самовосстановления исходного генофонда, что в свою очередь свидетельствует о большей приспособленности к местным условиям (надо заменить на следствием чего является высокий уровень приспособленности к местным условиям Южного Урала). Мы предполагаем, что процесс восстановления аборигенного генофонда мог произойти благодаря комплексному воздействию факторов окружающей среды, таких как природно-климатические, антропогенные, биогеоценотические и др. Естественно, что восстановление не могло бы произойти в случае, если генофонд местных пчел был бы полностью уничтожен. В данном случае произошел клас-сический процесс борьбы за существование, результатом чего стало вытеснение наименее приспособленных генотипов. Следует отметить, что генофонд современных пчел этого региона не остался прежним, а подвергся некоторым модификациям, существенно не влияющим на об-щий уровень приспособленности.
Выводы и предложения
Таким образом, выдвинутая нами гипотеза о возможном более ши-роком распространении ареала популяции Apis mellifera mellifera L. подтвердилась высокими результатами частоты (надо заменить на по результатам частоты) встречаемости комбинации PQQ у пчел исследуемых районов. Поскольку с момента повсеместной гибридизации прошло уже более полувека (надо заменить на более пятидесяти лет), очевидно, изучаемые нами популяции пчел восстановили свой исходный генофонд.
В настоящее время нами проводятся сравнительные популяционно-генетические исследования на основе полиморфизма микросателлитных локусов ядерного генома пчел. Мы предполагаем, что сходные результаты можно получить и по популяциям пчел других северных районов Республики Башкортостан, что может явиться целью наших дальнейших исследований.
The problem hybridization dark forest bees with the southern subspecies and preserve the gene pool of the Central Russian bee Apis mellifera mellifera L. is the main development of beekeeping Russia for more than half a century. Currently, their solutions are used both classic (analysis of phenotypic traits - exterior, morphological, economically useful, behavioral) (everything must be clean, as is already in the beginning) and modern molecular genetic methods for identification of race honey bees, which greatly increased the efficiency of analyzes with high number of hybrid families. We investigated areas also came under a massive experiment on hybridization, which was aimed at - improving ho zyaystvennopoleznyh signs of local bees. Our results suggest (should be changed to assume) that occurred in these populations of the recovery process (it is necessary to put the renewal of the) of the original gene pool, which in turn indicates a greater adaptability to local conditions (to be replaced by resulting in a higher level of fitness to the local conditions of the Southern Urals). We assume that the process of restoring native gene pool could occur due to the combined effect of environmental factors, such as climatic, anthropogenic, biogeocenotic and others. Of course, that recovery might not happen if the gene pool of native bees would have been completely destroyed. In this case, there was a class-rescattering of the process of the struggle for existence, which resulted in the ousting of the least adapted genotypes. It should be noted that the gene pool of modern bees in this region has not remained the same, but has undergone some modifications do not affect the overall level of fitness,.
Conclusions and suggestions
Thus, we put forward the hypothesis of a possible dissemination of the SI-rock area populations Apis mellifera mellifera L. results confirmed the high frequency (to be replaced by the results of the frequency) of occurrence of the combination of PQQ bees studied areas. Because since the widespread hybridization has been more than half a century (to be replaced by more than fifty years), it is obvious we are studying bee population regained its original gene pool.
Currently, we carry out a comparative population genetic studies based on polymorphism of microsatellite loci of the nuclear genome of bees. We believe that similar results can be obtained on populations of bees other northern areas of the Republic of Bashkortostan, which may be the aim of our further research. 
  062. Fahretdinova S.A., Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Prospects of wild bee populations preservation of burzyan districts in bashkortostan apis mellifera mellifera L. Materials of IV international conference of young scientists “Biodiversity. ecology. adaptation. evolution”. Odessa. 2009. C. 96.  

The area of a honeybee of subspecies Apts mellifera mdlijera L ( A bee of Middle Russian race) distribution covered extensive territory from the Britain to the Urals, along the northern border of the distribution of this species. Evolution of this subspecies took place in severe environmental conditions and as a result il has got the properties which have provided advantages over other subspecies. Throughout the XX-th century the area of Apis mellifera mellifera subspecies reduced as a result of hybridization with ofher subspecies. Several populations of Apis melufem mellifera are known in the Urals. In Bashkiria it is northern and southern (burzjanski) populations. Burzjan population is unique because it is rather large in size, it is highly isolated and is less subjected to anthropogenous influences.
Besides, cultivation of wild bees in Burzjansky area is preserved Bees population from apiaries plays a great role in wild bees preservation. There is constant exchange Between wild bees and bees from apiaries Population ot wild bees replenishes at the expense of bees from apiaries.
The example of South Ural forest reserve demonstrated that the оi.-.appearance of villages was followed bv wild bees. Therefore, to guarantee preservation of wild bees population, it is necessary to study genetic processes not only on the territory of forest reserve ^Shulgan-Tash» (where all the researches were mainly carried out). It is very important to investigate the population of the wnole this area.
  061. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Population genetics analysis of bees from populations of Ural and Volga regions. Materials of IV international conference of young scientists “Biodiversity. ecology. adaptation. evolution”. Odessa. 2009. C. 99-100.  

In Bashkortostan republic there is very hard problem of conservations of aboriginal bee subspecies A.m.mellifera. For conservations it is necessary identification  hybrid families, to eliminate their further distribution. Intergenic locus COI-COII of mtDNA varying among bees subspecies. There are the genetic markers of this locus allowing identify of hybrid origin bees colonies, in particular hybridization with bees from Caucasus (A.m.caucasica and A.m.armeniaca). In Bashkortostan republic we shown existence pool of the saved aboriginal bees in the north of republic on territory of several districts (Тatyshlynski, Birski, Кaraidelski, Мishkinski, Buraevski and Аskinski) and in the south of republic on territory of Burzyan district.
 We studied populations of bees on territory of several regions of Ural and Volga region. Large populations of bees A.m.mellifera on our researches was saved on territory of Permski oblast, Bashkortostan republic and republic Udmurtiya. The higher degree of hybridization is observed in bee population on territory of the Chelyabynski and Sverdlovski oblast. On the basis of the conducted researches it is already possible to make the map of geographical distribution of natural area of aboriginal bee A.m.mellifera.
 Genetic relatedness of A.m.mellifera populations we show using nuclear DNA locuses, in particular microsatellites ap243, 4a110, ap049, a113, a43, a8. On the grouping of population influences both community of their origin and their geographical location in relation to each other. Cluster analysis was conducted using neighbour joining method. On built dendrogram Bee population of Iglinski district grouping separately from other populations of Bashkortostan republic. On dendrogram bee populations of different regions (Bashkortostan republic, Permski oblast, republic Udmurtiya and Sverdlovskaya oblast) population of bees of Sverdlovskaya oblast is disposed separately. Such separate location of bees population of Iglinski district of Bashkortostan republic and Sverdlovskaya oblast is explained by their hybrid origin. Our laboratory plans to extend genetic researches of bees populations on territory of Russia and also  countries of CIS.
  060. Шареева З.В., Ильясов Р.А., Кутлин Н.Г., Поскряков А.В., Николенко А.Г. Изучение генетической структуры северной части ареала башкирской популяции Apis mellifera mellifera L. Вестник Оренбургского государственного университета. 2009. № 6 (100). С. 427-428.

Изучение генетической структуры северной части ареала башкирской популяции Apis mellifera mellifera L. (The study of the genetic structure of the northern part of the area of the Bashkir population of Apis mellifera mellifera L.)
Нами был изучен уровень генетического разнообразия северной части ареала башкирской популяции A.m.mellifera на основе F-коэффициентов и гетерозиготности, рассчитанных по данным частот аллелей и генотипов микросателлитных локусов ap243, 4a110 и А8 ядерной ДНК.
We have studied the level of genetic diversity northern part of the area of the Bashkir population Ammellifera based on F-ratio and heterozygosity calculated according to the allele and genotype frequencies of microsatellite loci ap243, 4a110 A8 and nuclear DNA.
Publication Name: Shareeva ZV, Ilyasov R.A., Kutlin NG, Poskryakov A.V. Nikolenko A.G. The study of the genetic structure of the northern part of the area of the Bashkir population of Apis mellifera mellifera L. Bulletin of the Orenburg State University. 2009. V. 6 (100). P. 427-428.
  059. Ильясов Р.А., Шареева З.В., Поскряков А.В., Николенко А.Г. Сравнительный анализ нуклеотидной последовательности фрагмента гена ND2 мтДНК в популяциях пчел республики Башкортостан. Вестник Оренбургского государственного университета. 2009. № 6 (100). С. 155-156.  

Сравнительный анализ нуклеотидной последовательности фрагмента гена ND2 мтДНК в популяциях пчел республики Башкортостан (Comparative analysis of the nucleotide sequence of the gene fragment ND2 of mtDNA in populations of bees of the republic of Bashkortostan)
В статье приводятся результаты сравнительного анализа нуклеотидной последовательности фрагмента гена ND2 мтДНК пчел Бирского района и пчел A.m.mellifera и A.m.caucasica. Кластерный анализ показал большее сходство пчел бирской популяции с A.m.mellifera, чем с A.m.caucasica.
The article presents the results of a comparative analysis of the nucleotide sequence of the gene fragment of mtDNA ND2 bees and bees Birsky District Ammellifera and Amcaucasica. Cluster analysis showed greater similarity with the populations of bees Birsk Ammellifera, than Amcaucasica.
Publication Name: Ilyasov R.A., Shareeva ZV, Poskryakov A.V. Nikolenko A.G. Comparative analysis of the nucleotide sequence of the gene fragment ND2 of mtDNA in populations of bees of the republic of Bashkortostan. Bulletin of the Orenburg State University. 2009. V. 6 (100). P. 155-156.
  058. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Экспериментальные исследования пчел Урала и Поволжья. Экологический мониторинг и биоразнообразие. 2009. № 4 (1-2). С. 61-62.  

Экспериментальные исследования пчел Урала и Поволжья (Experimental studies of bees of Urals and the Volga region) Самым новым и многообещающим методом генетической анализа пчел является изучение полиморфизма SNP, на основе чего можно будет составить генетический паспорт пчелы, очень быстро и дешево определить подвидовую принадлежность пчел и филогенетический паттерн. На сегодняшний день для медоносной пчелы известно несколько тысяч SNP (Whitfield et al., 2006). Изучение генетической вариабельности в популяции пчел Урала и Поволжья было выполнено нами с использованием порядка 10 генетических маркеров. Оказалось, что пчелы не по всем маркерам обладают значительным полиморфизмом. Так микросателлитный локус ар049 в популяции пчел Башкортостана обладал очень незначительным полиморфизмом и в дальнейшем не был использован. Значительным полиморфизмом обладали микросателлитные локусы - ар243, 4al 10, А8, А113 ядерной ДНК. Очень интересный полиморфизм наблюдался у меж- генного локуса COI-COII мтДНК, где мы обнаружили существование 4 гаплотипов (Q, PQ, PQQ и PQQQ). Кроме того, в популяции пчел Урала и Поволжья полиморфным является ген антибактериального пептида дефензина (Львов, 2002) ядерной ДНК. Оказалось, что для большинства популяций пчел, где не происходит массовый ввоз семей, наблюдается некоторая доля инбридинга, тогда как в популяциях, в которые завозят пчел извне, наблюдается аутбридинг. The newest and most promising method Genetic analysis is the study of bees polymorphism SNP, on the basis of which can be make genetic passport bees, very quickly and cheaply identify subspecies bees and phylogenetic pattern. To date, for the honeybee several thousand known SNP (Whitfield et al., 2006). The study of genetic variability in bee population of the Urals and the Volga region was carried out us with the order of 10 genetic markers. It was found that the bees not all markers have significant polymorphism. So microsatellite loci ar049 in the population of bees Bashkortostan had a very slight polymorphism and subsequently was not used. considerable polymorphism had microsatellite loci - Ar243, 4al 10, A8, A113 nuclear DNA. very Much interesting polymorphism observed in inter- gene locus COI-COII mtDNA where we found the existence of four haplotypes (Q, PQ, PQQ and PQQQ). Furthermore, in the bee population Urals and the Volga is a polymorphic gene defensin antimicrobial peptides (Lviv, 2002) of nuclear DNA. It turned out that for most bee populations where there is no mass import families, there is some share of inbreeding, whereas in populations in which bees are imported from outside, there is outbreeding. Publication Name: Ilyasov RA, Poskryakov AV, Nikolenko AG Experimental studies of bees of Urals and the Volga region. Environmental monitoring and biodiversity. 2009. V. 4 (1-2). P. 61-62.
  057. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Внутривидовая подразделенность медоносной пчелы вида Apis mellifera L. Материалы международной научной конференции "Синтетическая теория эволюции: состояние, проблемы, перспективы". Луганск. 2009. С. 32-34.  

Вид Apis mellifera L. занимал обширный ареал, включающий Африку, Европу и Ближний Восток. В последнее время в результате антропогенной деятельности возникли гибридные популяции, далеко отстоящих друг от друга популяций, которые в естественных условиях не встречаются друг с другом.
В результате морфометрических исследований F.Ruttner (1992) выделил 25 подвидов Apis mellifera L. (см. рис.) Большое число подвидов обусловлено, по-видимому, изоляцией и последующим накоплением генетических различий. В Европе такая изоляция могла возникнуть в результате оледенения в Плейстоценовый период (Ruttner, 1992). В Африке изоляция, возможно, происходила в результате процессов опустынивания, а также наличия естественных преград в виде горно-лесных массивов. Так, A.m.sahariensis была изолирована процессами опустынивания, а A.m.monticola – горно-лесными массивами (Arias, 1996). F.Ruttner с соавт. (1978) морфометрическими исследованиями показали разделение Apis mellifera L. на четыре подвидовые группы: A, M, C и O.
Группа А, включала африканские подвиды: A.m.lamarckii, A.m.yemenitica, A.m.litorea, A.m.scutellata, A.m.monticola, A.m.adansonii, A.m.unicolor, A.m.capensis. Группа М включала подвиды из Северной Европы, Пиренейского полуострова и Северной Африки: A.m.mellifera, A.m.iberica, A.m.intermissa, A.m.sahariensis, A.m.major. В группу С входят подвиды из Восточной Европы, Северного Средиземноморья, Центральной и Восточной Европы, Балканского полуострова и Кавказа. Позже F. Ruttner (1988, 1992) разделил группу С на две С и О. В новую группу С стали входить подвиды из Центральной и Восточной Европы и Балканского полуострова: A.m.ligustica, A.m.carnica, A.m.macedonica, A.m.cecropia, A.m.sicula. Группа О является основной группой подвидов с Кавказа, Средиземноморья и Ближнего Востока: A.m.caucasica, A.m.armeniaca, A.m.meda, A.m.anatoliaca, A.m.syriaca, A.m.cypria, A.m.adami.
Современные исследования показали низкий уровень аллозимного полиморфизма A.mellifera в Турции (Kandemir с соавт., 2000) и заповеднике “Шульган-Таш” (Янбаев с соавт., 2000). По этой причине аллозимы не могут быть успешно использованы в филогенетических исследованиях.
Первые успехи в филогенетике, систематике и поиске маркеров были сделаны в RFLP мтДНК (Smith, 1988; Smith с соавт., 1989,1991; Arias с соавт., 1990; Sheppard с соавт., 1991; Garnery с соавт., 1993; Meixner с соавт., 1993), RAPD анализе (Blanchetot, 1991, 1992; Hunt, Page, 1995), исследовании микросателлитных повторов (Tares с соавт., 1993; Estoup с соавт., 1995), секвенционном анализе мтДНК (Arias с соавт., 1996) и RFLP ядерного генома (Hall, 1998).
Исследования D.R.Smith (1991) с использованием метода RFLP и J.M.Cornuet с соавт. (1991), L.Garnery с соавт. (1992) методом секвенирования мтДНК показали филогенетическую картину, где подтверждается наличие четырех подвидовых групп Apis mellifera L., как и у F.Ruttner с соавт. (1978). Однако группы М и О F. Ruttner с соавт. (1978) по составу значительно отличаются. Работа M.Arias с соавт. (1996) с применением секвенса митохондриальной ДНК подтверждает предыдущие результаты молекулярно-генетичеких исследований.
A.Estoup с соавт. (1995) в своих исследованиях по семи микросателлитным локусам A113, B124, A7, A24, A28, A88, A43 подтвердил существование и состав трех эволюционных ветвей, первоначально выделенных F.Ruttner (1988), где каждая ветвь