Институт биохимии и генетики
Уфимского научного центра
Российской академии наук

Institute of biochemistry and genetics
of Ufa scientific center
of Russia academy of sciences
Лаборатория биохимии адаптивности насекомых The Laboratory of biochemistry of insects adaptability
Заведующий лабораторией
д.б.н., проф. Алексей Геннадьевич Николенко
Head of the The Laboratory is
Doctor, Prof. Aleksey Gennadyevich Nikolenko
Старший научный сотрудник
к. б. н. Рустем Абузарович Ильясов
Senior Researcher
Ph. D. Rustem Abuzarovich Ilyasov
Cписок публикаций List of publications
Статьи в PDF для скачивания Articles in PDF for Downloads

Ильясов Р.А. Ilyasov R.A.
 

  001. Ильясов Р.А., Николенко А.Г. Полиморфизм локуса COI-COII митохондриальной ДНК пчелы Пермской области. Материалы III съезда всероссийского общества генетиков и селекционеров "Генетика в XXI веке: современное состояние и перспективы развития". Москва. 2004. Т.1. С. 202.

Северная прикамская популяция медоносной пчелы среднерусской расы Apis mellifera mellifera на данный момент малоизучена (Петухов и др, 1996). Она занимает территорию бассейна реки Камы между 56-62 с.ш. и 52-59 в.д. Это северная граница естественного ареала медоносной пчелы, которая простирается от хвойно-широколиственной подзоны на юге до северной среднетаежной подзоны на севере. По данным А.В. Петухова и др. (1996), пчелы Пермской области принадлежат среднерусской расе. А.В. Петухов выделил две четко различающиеся группы прикамских пчел из двух разных подзон тайги: уинская группа – на юге и вишерская группа – на севере (Петухов и др, 1996).
Целью нашего исследования является изучение структуры популяции медоносной пчелы прикамской популяции, определение полиморфизма локуса COI-COII митохондриального ДНК, что является маркером расовой принадлежности пчел (Николенко и др., 2002) и сравнение полученных данных с морфометрическими данными.
Для исследования был собран материал из семи районов Пермской области:
Красновишерского р-на – 2 пасеки (32 улья), Нытвенского р-на – 1 пасека (9 ульев), Пермского р-на - 1 пасека (23 улья), Осинского р-на - 1 пасека (9 ульев), Частинского р-на - 1 пасека (5 ульев), Ординского р-на - 2 пасеки (20 ульев), Уинского р-на – 3 пасеки (36 ульев).
Пчеловодные хозяйства Нытвенского, Частинского, Уинского, Красновишерского, Кунгурского районов являются племенными и разводят пчел среднерусской расы (Петухов и др, 1996; Бояршинов и др., 2001). Однако результаты анализа локуса COI-COII митохондриального ДНК показали присутствие в выборке популяции Уинского района около 30% гибридизированных семей. Молекулярно-генетические методы позволяют выявить помесные семьи, которые могут остаться незамеченными при использовании только морфометрического метода, поэтому необходимо совместное использование обоих методов.
Результаты нашего исследования подтвердили выявленную ранее относительную однородность прикамской популяции медоносной пчелы. По результатам изучения пасек двух групп прикамской популяции медоносной пчелы, в вишерской группе 100%, а в уинской – только 70% пчел среднерусской расы Apis mellifera mellifera.
North Prikamskaya population of Central honeybee Apis mellifera mellifera race at the moment little studied (Petukhov et al, 1996). It covers an area between the Kama River Basin 56-62 N and 52-59 E It is the northern boundary of the natural range of the honey bee, which stretches from the coniferous-deciduous subzone in the south to the northern middle taiga subzone in the north. According to AV Petukhov et al. (1996), bees belong to the Perm region of Central race. AV Petukhov identified two distinct groups of Kama bees from two different subzones taiga uinskaya group - in the south and Visherskaya group - in the north (Petukhov et al, 1996).
The aim of our study is to investigate the population structure of the honeybee population in Kama region, the definition of polymorphism locus COI-COII mitochondrial DNA, which is a marker of racial bees (Nikolenko et al., 2002) and comparing the data obtained with morphometric data.
To study the material was collected from seven districts of the Perm region:
Krasnovishersky district - 2 apiary (beehive 32) Nytvensky district - 1 apiary (beehives 9), Perm district - 1 apiary (beehive 23) Osa district - 1 apiary (beehives 9), p Chastinskogo -on - 1 apiary (5 hives), Orda district - 2 apiary (20 hives) Uinskogo district - 3 apiary (36 hives).
Beekeeping economy Nytvensky, Chastinskogo, Uinskogo, Krasnovishersky, Kungurskoe areas are tribal and Central Russian breed of bees race (Petukhov et al, 1996; Boyarshinov et al., 2001). However, an analysis of locus COI-COII mitochondrial DNA showed the presence in the sample population Uinskogo area about 30% hybridized families. Molecular genetic methods allow to identify the hybrid family that can go unnoticed when only morphometric method, so you need to share both.
The results of our study confirmed the previously identified the relative homogeneity of the Kama region honeybee populations. As a result of the study of two groups of apiaries in Kama region of honeybee populations in Visherskaya group 100% and uinskoy - Only 70% of Central bee race Apis mellifera mellifera.
  002. Ильясов Р.А., Николенко А.Г., Пономарев В.А., Ащеулов В. И. RAPD-PCR полиморфизм популяций шмеля Bombus terrestris (L.). Материалы 55-ой международной научно-практической конференции "Актуальные проблемы науки в агропромышленном комплексе". Кострома. 2004. Т. 2. С. 99-100.

С развитием шмелеводства возрастает актуальность научных исследований в этой области, в том числе популяционно-генетических исследований. Целью данной рабогы был сравнительный анализ RAPD полиморфизма шмелей ряда популяций Bombus terrestris.
ДНК шмелей выделялась из грудных мышц методом экстракции в системе фенол- хлороформ с добавлением саркозила. Для проведения RAPD-PCR использовались праймеры 949 (5’-GTTGGCCGACGTATА-3 ’) и 950 (5’-GACCTCAGCACGACC-3’). Программа для амплификации (35 циклов): (92° - 40 с) - (48° - 60 с) - (72° - 80 с).
Было выявлено 12 полос RAPD фрагментов, где полиморфными являлись 9 полос, а мономорфными 3 полосы. На основании полиморфных фрагментов RAPD-спектров была построена матрица ’’объект-признак” и определены частоты встречаемости фрагментов в исследованных выборках (табл. I).
Фрагменты, соответствующие 95% критерию полиморфнасти, были использованы для расчета генетических расстояний между популяциями шмелей по формуле М.Нея fNei. 1975).
Кластерный анализ, основанный на рассчитанных нами генетических расстояниях, показал высокую степень близости между выборками из краснодарской и голландской популяций. Очень близко к ним расположена израильская популяция. Все три выборки могут быть продуктом искусственного разведения, полученным практически из одного источника (или из 2-3 близкородственных). Природные выборки из нижненовгородской и воронежской популяций существенно отличались от остальных. Как следствие, это, во-первых, подтверждает наличие генетически отличающихся популяций в данных регионах, во-вторых, эти популяции могуч служить ценным источником генетического материала для внутривидового скрещивания.
На основе базовой матрицы были рассчитаны коэффициенты биоразнообразия для исследуемых популяций (табл. 3). Однако однозначные комментарии к таблице сделать трудно из-за разного объема выборок, что могло отразиться на ветчине коэффициента.
Уровень биоразнообразия - показатель стабильности популяции. Представления об оптимальной гетерозиготности как мере максимума адаптации популяции к конкретной среде, в которой они сформировались и обитают ныне, сформулированы Ю.ПАптуховым (Алтухов, 1972). Высокая гетерозшотность, будучи выгодной для отдельной особи, может оказался нежелательной для приспособленности популяции в целом, так как количество выще- пляемых !енотинов оказывается неадаптивным.
Таким образом, в дальнейшем полученные нами значения популяционного биоразнообразия шмелей можно сравнивать с будущими данными и на основе этою сравнения делать выводы о ходе развития популяции, характере изменения ее гетерогенности, оптимизировать ход развития популяций. При искусственном вое произволе гве популяций важно помнить, что каждая из них имеет свой эволюцпонно сложившийся биологический оптимум биоразнообразия, определяемый предшествующей эволюцией и современным положением популяции в экосистеме. Границы такого оптимума задаются её минимальным и максимальным уровнями, устойчивые опенки которых могут быть получены через усреднение результатов нескольких наблюдений. Без знания параметров зоны нуклеотидной сбалансированности генофондов, их успешное сохранение и воспроизводство крайне затруднительно.
With the development of shmelevodstva increases the relevance of research in this area, including population genetic studies. The purpose of this comparative analysis was rabogy RAPD polymorphism number of populations of bumblebees Bombus terrestris.
DNA was extracted from bumblebees pectoral muscles by extraction in the phenol-chloroform with the addition of Sarkozy. For carrying RAPD-PCR primers 949 (5'-GTTGGCCGACGTATA-3 ') and 950 (5'-GACCTCAGCACGACC-3'). The program for amplification (35 cycles): (92 ° - 40) - (48 ° - 60) - (72 ° - 80).
It was revealed 12 bands RAPD fragments, where polymorphic bands were 9 and 3 monomorphic strip. On the basis of polymorphic fragments RAPD-spectra matrix was built '' object-sign "and the frequencies of occurrence of fragments in the studied samples (Table. I).
The fragments corresponding to the 95% criterion polimorfnasti, were used to calculate genetic distances between populations of bumblebees formula M.Neya fNei. 1975).
Cluster analysis based on genetic distances calculated by us, showed a high degree of similarity between the samples from the Krasnodar and Dutch populations. Very close to it is the Israeli population. All three samples may be a product of artificial breeding obtained practically from one source (or closely related 2-3). Natural selection from nizhnenovgorodskoy and Voronezh populations differed significantly from the others. As a consequence, it is, first, confirms the presence of genetically diverse populations in these regions, and secondly, E1I population mighty serve as a valuable source of genetic material for intraspecific crosses.
Based on matrix of coefficients were calculated for the study of biodiversity of populations (Table. 3). However, unambiguous comments to the table to make difficult because of the different sample sizes that could affect the ham factor.
The level of biodiversity - an indicator of the stability of the population. Submissions on best heterozygosity as a measure of the maximum adaptation of the population to the specific environment in which they were formed and now live formulated Yu.PAptuhovym (Altukhov, 1972). High geterozshotnost being profitable for a private individual, it may not be desirable to accommodate the population in general, as the number of leached plyaemyh! Enotinov is maladaptive.
Thus, in the future our values ​​ass.] [Yatsionnogo biodiversity bumblebees can be compared with future data, and based on the comparison etoyu draw conclusions about the development of the population, changes in the nature of its heterogeneity, optimize course of populations. With artificial howling outrage gve populations is important to remember that each of them has its evolyutsponno prevailing biological optimum biodiversity, defined the evolution of the previous and current status of populations in an ecosystem. The boundaries of the optimum set its minimum and maximum levels of resistant Estimates which can be obtained by averaging the results of several observations. Without knowing the parameters of the zone balance nucleotide gene pools, their successful conservation and reproduction is extremely difficult.
  003. Ilyasov R.A., Baymiev A.K., Poskryakov A.V., Nikolenko A.G. Phylogenetics researches in Apis mellifera mellifera L. concluded from mitochondrial DNA sequence in Urals. GenBank. 2005. accession numbers DQ181611-DQ181622 (http://www.ncbi.nlm.nih.gov).  

Apis mellifera pop-variant Burzyanskii, Borti NADH dehydrogenase subunit 2 (ND2) gene, partial cds; mitochondrial
GenBank: DQ181611.1
FASTA Graphics PopSet
Go to:
 LOCUS       DQ181611                 615 bp    DNA     linear   INV 26-SEP-2005
DEFINITION  Apis mellifera pop-variant Burzyanskii, Borti NADH dehydrogenase
            subunit 2 (ND2) gene, partial cds; mitochondrial.
ACCESSION   DQ181611
VERSION     DQ181611.1  GI:75863966
KEYWORDS    .
SOURCE      mitochondrion Apis mellifera (honey bee)
  ORGANISM  Apis mellifera
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
            Aculeata; Apoidea; Apidae; Apis.
REFERENCE   1  (bases 1 to 615)
  AUTHORS   Ilyasov,R.A., Baymiev,A.K., Poskryakov,A.V. and Nikolenko,A.G.
  TITLE     Phylogenetics researches in Apis mellifera mellifera L. concluded
            from mitochondrial DNA sequence in Urals
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 615)
  AUTHORS   Ilyasov,R.A., Baymiev,A.K., Poskryakov,A.V. and Nikolenko,A.G.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-AUG-2005) Russian Academy of Sciences, Ufa Scientific
            Center, Institute of Biochemistry and Genetics, Prospect Octyabrya,
            71, Ufa 450054, Russia
FEATURES             Location/Qualifiers
     source          1..615
                     /organism="Apis mellifera"
                     /organelle="mitochondrion"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:7460"
                     /sex="worker"
                     /tissue_type="thorax"
                     /dev_stage="adult"
                     /pop_variant="Burzyanskii, Borti"
                     /country="Russia: Bashkortostan"
     gene            1..>615
                     /gene="ND2"
     CDS             1..>615
                     /gene="ND2"
                     /codon_start=1
                     /transl_table=5
                     /product="NADH dehydrogenase subunit 2"
                     /protein_id="ABA29194.1"
                     /db_xref="GI:75863967"
                     /translation="MFFMNFKYHWFIYLLITIFVLMMNSNNIFIQWMLMEFGTIISIS
                     LINIKSTNKTPSLIYYSVSVISSIFLFFMIIVYLSSISFTKTDTFNFMVQMMFFLKIG
                     TFPFHFWMIYSYEMMNWKQIFLMSTLIKFIPIYMMVSMTKINSWTLYFLITNSLYISF
                     YANKFYTLKKLLACSTIFNSFYFIFILELNKNMFIAMIILYSFNY"
ORIGIN     
        1 attttcttca taaattttaa ataccactga tttatttatc ttttaattac tatttttgta
       61 ttaataataa attccaataa tatttttatt caatgaatat taatagaatt tggtacaatc
      121 attagaatta gattaattaa tattaaatcc acaaataaaa ccccaagatt aatttattat
      181 tcagtatcag taatttcaag aattttttta ttctttataa ttattgtata cttatcatcc
      241 attagattta ctaaaacaga tacttttaat tttatagttc aaataatatt ttttttaaaa
      301 attggaactt tcccttttca tttttgaata atttattctt atgaaataat aaattgaaag
      361 caaatttttt taatatcaac attaattaaa tttattccaa tttatataat agtttcaata
      421 actaaaatta attcatgaac attatatttt ttaattacaa atagattata tatttcattt
      481 tatgcaaata aattttatac tctaaaaaaa ttattagcat gctcaacaat ttttaattca
      541 ttctatttta tttttatttt agaattaaac aaaaatatat ttattgctat aattatttta
      601 tattcattta attat
//
  004. lyasov R.A. Four populations of Apis mellifera mellifera L. in Urals. Apis-UK No.38. August 2005. (http://www.beedata.com/apis-uk/newsletters08/index.htm).

Apis mellifera mellifera L. is a very interesting honey bee. Its high cold endurance and high capacity for work had made it indispensable for northern beekeeping in the Urals. The climate of the the Urals is very inhospitable with long winters and short summers. The bees of the Urals are therefore special dark European bees adapted to the region. Unfortunately, many areas were hybridizated by Apis mellifera caucasica.
In the biochemistry and insect adaptability laboratory we carry out research into these autochtonous honey bees. We use different methods for the identification of the dark european bee population. We found in the Bashkortostan republic and the Perm oblast (Russia, South and Middle Urals) four unique not hybridizated populations of Apis mellifera mellifera by morphometrical, molecular methods. We investigated by PCR analysis of the intergenic region COI-COII; microsatellite locii 4A110, Ap243, Ap049; the locus of gene antibacterial peptide defensin; locus of 2 subunit NADH dehydrogenase (ND2). We sent sequences of the ND2 gene to GenBank. Future plans include identification of new dark european honey bees in other regions of Russia.
Our investigations will also help to restore the native gene pool of Apis mellifera mellifera L. in the hybridizated regions. We would be glad to collaborate with other European bee researchers and beekeepers. We think, all subspecies of bees must live separately and must not be hybridized. We must save unique dark European honey bee.
  005. Ильясов Р.А., Петухов А.В., Поскряков А.В., Николенко А.Г. Поиск генетических резерватов Apis mellifera mellifera на Урале на основе полиморфизма митохондриальной ДНК. Материалы XII молодежной научной конференции "Актуальные проблемы биологии и экологии". Сыктывкар. 2005. C. 97-98.

По морфометрическим исследованиям Ruttner’a (1988) вид Apis mellifera L. подразделяется на 25 географических рас или подвидов. Их ареалы очень малы и, в основном, расположены в зоне с теплым климатом. Только подвид Apis mellifera mellifera занимает огромную территорию вдоль северной границы естественного ареала в лесной и лесостепной зонах Европы, где довольно холодный климат. Таким образом, Apis mellifera mellifera представляет огромную ценность для пчеловодства России, северо-вропейских и других стран, являясь уникальным подвидом, который оптимален для разведения в зоне с холодным умеренно-континентальным климатом. Однако, ареал Apis mellifera mellifera постоянно сокращается из-за гибридизации с другими подвидами. В результате икусственных миграций подвидов гибриды широко распространились по всему ареалу и даже стали численно превосходить[2].
По данным Саттарова (2000) на территории Башкортостана в Бурзянском районе сохранилась локальная популяция Apis mellifera mellifera. Морфометрические измерения А.В. Петухова (1996) позволяют предположить, что локальные популяции Apis mellifera mellifera сохранились в Пермской области в Красновишерском и Уинском районах. Для сохранения и восстановления генофонда на всем ареале необходимо иметь, как минимум, несколько резерватов негибридизованного аборигенного генофонда, которые будут использоваться в искусственном восстановлении. Поэтому необходимо выяснить нынешнее состоянии обнаруженных ранее локальных популяций и вести поиск еще неизвестных популяций Apis mellifera mellifera. Огромная территория Урала, покрытая лесами, еще не изучена полностью, и есть большие шансы, что существуют другие локальные популяции Apis mellifera mellifera.
Мы применили метод изучения полиморфизма локуса COI-COII мтДНК [1], позволяющий быстро и точно выявить происхождение семей пчел по материнской линии, для поиска еще не выявленных ранее локальных популяций подвида Apis mellifera mellifera на Урале.
Нами было проанализировано 134 семьи в Пермской области, где выделили вишерскую и южно-прикамская локальные популяции, где частота встречаемости аллеля PQQ близка к 100%. Предположение А.В. Петухова (1996), о существовании уинской локальной популяции не подтвердилось. Кроме того, мы проанализировали 365 семей в республике Башкортостан. Была выделена татышлинская локальная популяция, дополнительно к ранее изученной Саттаровым (2000) бурзянской, частота встречаемости аллеля PQQ которой также близка к 100%.
Таким образом, обнаруженные 4 локальные популяции могут быть выделены, как генетические резерваты Apis mellifera mellifera на Урале и использоваться в востановлении генофонда.
By morphometric study Ruttner'a (1988) kind of Apis mellifera L. is divided into 25 geographical races or subspecies. They are very small and ranges, are mainly located in the zone with a warm climate. Only the subspecies Apis mellifera mellifera occupies a vast territory along the northern border of natural habitat in the forest and steppe zones of Europe, where relatively cold climate. Thus, Apis mellifera mellifera is of great value for beekeeping Russia, north of the WHO European and other countries, as a unique subspecies, which is optimal for breeding in the area with a cold temperate continental climate. However, the area of ​​Apis mellifera mellifera is steadily declining due to hybridization with other subspecies. As a result of migration ikusstvennyh subspecies hybrids are widely spread throughout the entire range, and even began to outnumber [2].
According Sattarova (2000) on the territory of Bashkortostan region Burzyan save a local population of Apis mellifera mellifera. The morphometric measurements AV Petukhov (1996) suggest that local populations Apis mellifera mellifera preserved in the Perm region in Krasnovishersk and Uinskom areas. To save and restore the gene pool in the whole area, you must have at least a few reserves unhybridised aboriginal gene pool to be used in artificial restoration. It is therefore necessary to find out the current status of the detected earlier local populations and to seek yet unknown populations of Apis mellifera mellifera. The vast territory of the Urals, covered with forests, not yet fully explored, and there is a great chance that there are other local populations of Apis mellifera mellifera.
We have applied the method of studying the polymorphism locus COI-COII mtDNA [1], allowing you to quickly and accurately identify the origin of bee families on the maternal side, to find has not previously identified local populations subspecies Apis mellifera mellifera in the Urals.
We have analyzed 134 families in the Perm region, where isolated Visherskaya and South Prikamskaya local populations where the incidence of allele PQQ is close to 100%. The assumption A. Petukhov (1996), the existence of uinskoy local population has not been confirmed. In addition, we analyzed 365 families in the Republic of Bashkortostan. It was allocated tatyshlinskaya local population, in addition to the previously studied Sattarov (2000) Burzyan, frequency of allele PQQ which is also close to 100%.
Thus, found 4 local populations can be isolated as genetic reserves Apis mellifera mellifera in the Urals and used in restoring the gene pool.
  006. Ильясов Р.А. Полиморфизм локуса COI-COII мтДНК медоносной пчелы среднерусской расы Apis mellifera mellifera L. на Урале. Материалы III конкурса научных работ молодых ученых и аспирантов УНЦ РАН и АН РБ. Уфа. 2005. С. 74-76.  

Естественный ареал медоносной пчелы Apis mellifera L [Скориков, 1936] охватывает значительную часть Старого Света: Африку, Ближний Восток и всю Европу до Уральских гор. В пределах этого ареала вид Apis mellifera подразделяется на 24 географические расы [Ruttner, 1988]. Только среднерусская раса Apis mellifera mellifera освоила огромную территорию вдоль северной границы видового ареала. Эта территория протянулась вдоль лесной и лесостепной зон через всю Европу [Николенко, 2002]. С расширением ареала Apis mellifera mellifera происходит усиление расовой дифференциации и усложнение генетической структуры популяции пчелы среднерусской расы [Гранкин, 1998]. Закономерности географической и клинальной изменчивости пчел среднерусской расы изучали А.С.Михайлов (1930), А.С.Скориков (1936),В.В.Алиатов (1948). Однако только клинальный характер изменения морфометрических признаков не может объяснить всю сложность структуры популяции пчелы среднерусской расы. Такая недостаточная изученность пчел Урала представляет интерес для дальнейших исследований.
За последние два века ареал А. т. mellifera существенно сократился из-за гибридизации с другими расами A. mellifera. Благодаря деятельности человека гибридные формы пчел получили широкое распространение, что существенно снизило уровень адаптированности популяций к окружающей среде [Черевко, 1995]. В настоящее время по всему ареалу пчелы среднерусской расы преобладают гибриды разных поколений. Россия, вероятно, еще облада- етрезервами для восстановления генофонда^. т. mellifera. Г 1о данным В.1 1.Сат- тарова (2000) и А.В.Петухова (1996), на Урале еще сохранились локальные популяции пчелы среднерусской расы. Освоение огромных медоносных ресурсов России, расположенных в центральных и северных районах европейской части страны, невозможно без использования генофонда самой зимостойкой из всех рас пчел - среднерусской [Гранкин, 1997]. Среднерусские пчелы незаменимы в северных европейских районах ее ареала, на Урале и в Сибири, где сосредоточены основные медовые запасы России [Гранкин, 1998].
Среди локальных популяций среднерусских пчел наиболее известны башкирские, алтайские и полесские [Билаш, 1991]. Фактические данные о состоянии генофонда башкирской популяции медоносной пчелы в последнее десятилетие не публиковались [Николенко, 2002]. Медоносная пчела среднерусской расы все еще ост ае тся малоизученным объектом. В частности, это относится к пчеле Пермской области, территория которой расположена на северной границе естественного ареала медоносной пчелы [Петухов и др., 1996].
Было проанализировано 268 особей пчел из 134 семей в 7 районах Пермской области, где материал собирался совместно с преподавателем ПГПУ А.В.Петухо- вым и 730 особей пчел из 365 семей в 3 районах Республики Башкортостан (Та- тышлинский, Ипшнский и Бурзянский). По подсчетам частот встречаемости аллелей выделили районы, ще доля аллеля PQQ выше 0,9. В Пермской области вьще- лили две такие популяции - Вишерская, куда входят пасеки Красновишерского района, и Южная прикамская популяция, куда входят пасеки Ординского, Частин- ского, Нытвенского, Пермского, Осинского районов. В Уинском районе, в отличие от результатов А.В.Пстухова, доля аллеля PQQ меньше 0,9. В Республике Башкортостан была выделена Татышлинская популяция, куда входят пасеки Та- тышлинского района. Повторно подтвердилась принадлежность Бурзянской популяции к среднерусской расе. В Hi линском районе доля аллеля PQQ меньше 0,9.
Таким образом, на Урале выделены четыре сохранившиеся локальные популяции медоносной пчелы среднерусской расы, которые в дальнейшем будут объявлены как генетические резерваты.
The natural habitat of the honey bee Apis mellifera L [Skorikov 1936] covers a large part of the Old World: Africa, the Middle East and the whole of Europe to the Ural Mountains. Within this area kind of Apis mellifera is divided into 24 geographical races [Ruttner, 1988]. Only the Central Russian race Apis mellifera mellifera has mastered a vast territory along the northern border of the species area. This area stretches along the forest and steppe zones across Europe [Nikolenko, 2002]. With the expansion of the range Apis mellifera mellifera is a strengthening of racial differentiation and complexity of the genetic structure of populations of bees of Central race [Grankin, 1998]. Laws and geographical variability clinal Central Russian bees studied A.S.Mihaylov race (1930), A.S.Skorikov (1936), V.V.Aliatov (1948). However, only the nature of the change clinal morphometric characters can not explain the complexity of the structure of the population of Central bee race. This lack of scrutiny of bees Urals is of interest for further research.
Over the past two centuries range A. m. Mellifera has declined significantly due to hybridization with other species A. mellifera. Thanks to hybrid forms of human activity are widespread bee, which significantly reduced the level of adaptation of populations to the environment [Cherevko, 1995]. At present the entire range of Central bee race dominated by hybrids of different generations. Russia probably still oblada- etrezervami to restore ^ gene pool. m. mellifera. 1 ° F according to B.1 1.Sat- Tarova (2000) and A.V.Petuhova (1996), on the Urals still preserved local bee populations of Central race. The development of huge honey resources of Russia, located in the central and northern regions of the European part of the country is impossible without the use of the gene pool of all races hardy bees - of Central [Grankin, 1997]. Central Russian bees are indispensable in the northern European areas of its range, the Urals and Siberia, where the main reserves of honey Russia [Grankin, 1998].
Among the local populations of the Central Russian bees are best known Bashkir, Altai and marshy [Bilash, 1991]. Evidence on the state of the gene pool of the Bashkir honey bee population in the last decade have not been published [Nikolenko, 2002]. Honeybees of Central race still ost ae tsya little known subject. In particular, it relates to bee Perm region, whose territory is located on the northern border of the natural habitat of the honey bee [Petukhov et al., 1996].
We analyzed 268 specimens of 134 bee families in 7 districts of the Perm region, where the material is going to together with teacher PGPU A.V.Petuho- vym and 730 species of bees from 365 families in three districts of the Republic of Bashkortostan (Such tyshlinsky, Ipshnsky and Burzyan). According to estimates of the frequency of alleles identified areas shte share allele PQQ above 0.9. In the Perm region vsche- poured two such populations - Visherskaya, which includes apiary Krasnovishersky district, and South Prikamskaya population, which includes apiary Orda, Chastin- ray, Nytvensky, Perm, Osa region. In Uinskom area, in contrast to the results A.V.Pstuhova share allele PQQ less than 0.9. In the Republic of Bashkortostan has been allocated Tatyshlinskaya population, which includes apiary Such tyshlinskogo area. Reconfirm Burzyan belonging to the populations of Central race. The Hi Lynskey area share allele PQQ less than 0.9.
Thus, in the Urals identified four surviving local population of Central honeybee race, which will later be declared as genetic reserves.
  007. Ilyasov R.A., Komissar A.D., Baymiev A.K., Poskryakov A.V., Nikolenko A.G. Phylogenetics researches in Apis mellifera macedonica concluded from mitochondrial DNA sequence. GenBank. 2006. accession numbers DQ361088-DQ361090 (http://www.ncbi.nlm.nih.gov).

 Apis mellifera macedonica 98 colony NADH dehydrogenase subunit 2 (ND2) gene, partial cds; mitochondrial
GenBank: DQ361088.1
FASTA Graphics
Go to:
 LOCUS       DQ361088                 617 bp    DNA     linear   INV 08-FEB-2006
DEFINITION  Apis mellifera macedonica 98 colony NADH dehydrogenase subunit 2
            (ND2) gene, partial cds; mitochondrial.
ACCESSION   DQ361088
VERSION     DQ361088.1  GI:86440158
KEYWORDS    .
SOURCE      mitochondrion Apis mellifera macedonica
  ORGANISM  Apis mellifera macedonica
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
            Aculeata; Apoidea; Apidae; Apis.
REFERENCE   1  (bases 1 to 617)
  AUTHORS   Ilyasov,R.A., Komissar,A.D., Baymiev,A.K., Poskryakov,A.V. and
            Nikolenko,A.G.
  TITLE     Phylogenetics researches in Apis mellifera macedonica concluded
            from mitochondrial DNA sequence
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 617)
  AUTHORS   Ilyasov,R.A., Komissar,A.D., Baymiev,A.K., Poskryakov,A.V. and
            Nikolenko,A.G.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-JAN-2006) Russian Academy of Sciences, Ufa Scientific
            Center, Institute of Biochemistry and Genetics, Prospect Octyabrya,
            71, Ufa 450054, Russia
FEATURES             Location/Qualifiers
     source          1..617
                     /organism="Apis mellifera macedonica"
                     /organelle="mitochondrion"
                     /mol_type="genomic DNA"
                     /isolation_source="98 colony; apiary of A.D. Komissar"
                     /sub_species="macedonica"
                     /db_xref="taxon:200410"
                     /sex="worker"
                     /tissue_type="thorax"
                     /dev_stage="adult"
                     /country="Ukraine: Kiev"
     gene            1..>617
                     /gene="ND2"
     CDS             1..>617
                     /gene="ND2"
                     /codon_start=1
                     /transl_table=5
                     /product="NADH dehydrogenase subunit 2"
                     /protein_id="ABC95998.1"
                     /db_xref="GI:86440159"
                     /translation="MFFMNFKYHWFIYLLITIFVLMMNSNNIFIQWMLMEFGTIISIS
                     LINIKSTNKTPSLIYYSVSVISSIFLFFMIIVYLSSISFTKTDTFNFMVQMMFFLKIG
                     TFPFHFWMIYSYEMMNWKQIFLMSTLIKFIPIYMMVSMTKINSWTLYFLITNSLYISF
                     YANKFYTLKKLLACSTIFNSFYFIFILELNKNMFIAMIILYSFNY"
ORIGIN      
        1 atcttcttca taaattttaa ataccactga tttatttatc ttttaattac tatttttgta
       61 ttaataataa attccaataa tatttttatt caatgaatat taatagaatt tggtacaatc
      121 attagaatta gattaattaa tattaaatcc acaaataaaa ccccaagatt aatttattat
      181 tcagtatcag taatttcaag aattttttta ttctttataa ttattgtata cttatcatcc
      241 attagattta ctaaaacaga tacttttaat tttatagttc aaataatatt ttttttaaaa
      301 attggaactt tcccctttca tttttgaata atttattctt atgaaataat aaattgaaag
      361 caaatttttt taatatcaac attaattaaa tttattccaa tttatataat agtttcaata
      421 actaaaatta attcatgaac attatatttt ttaattacaa atagattata tatttcattt
      481 tatgctaata aattttacac tctaaaaaaa ttactagcat gttcaacaat ttttaattca
      541 ttctatttta tttttatttt agaattaaat aaaaatatat ttattgctat aattatttta
      601 tattcattta attattt
//
  008. Ильясов Р.А., Поскряков А.В. Филогенетика подвидов Apis mellifera. Пчеловодство. 2006. №7. С. 18-19.  

Филогенетика подвидов Apis mellifera (Phylogenetics of subspecies of Apis mellifera)
современные филогенетические исследования проводят с использованием как морфологических, так и молекулярно-генетических методов. Схемы родства подвидов, построенные на основе использования разных методов, имеют определенную степень сходства в числе групп, однако часто возникают разногласия по вопросу состава каждой. Возможно, это следствие разной эволюционной значимости и коэффициента отбора локусов и выборки образцов, которые могли оказаться гибридными. Филогенетика пчел только начинает развиваться и сейчас представляет безграничное поле для дальнейших исследований. Конечная картина филогенетических отношений подвидов пчел должна получиться только на основе совокупного анализа всех накопленных за продолжительный период материалов по данной теме.
modern phylogenetic studies carried out using both morphological and molecular genetic methods. Scheme kinship subspecies that are based on the use of different methods, have a certain degree of similarity among the groups, but often there is disagreement on the issue of the composition of each. Perhaps this is a consequence of different evolutionary significance and coefficient selection and sampling of loci that could be hybrid. Phylogenetics bees just beginning to develop, and now is a boundless field for further research. The final picture of the phylogenetic relationships subspecies of bees should be obtained only on the basis of cumulative analysis of all accumulated over a long period of material on the subject.
Publication Name: Ilyasov R.A., Poskryakov A.V. Phylogenetics of subspecies of Apis mellifera. Russian journal of Russian journal of beekeeping. 2006. V.7. P. 18-19.
  009. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Митохондриальная ДНК в изучении популяций пчел на Урале. Материалы межрегионального совещания энтомологов Сибири и Дальнего Востока. Новосибирск. 2006. С. 72-74.

На текущий момент подвиды подвержены интенсивной гибридизации, чего не избежала и популяция A.m.mellifera – основной компонент эволюционной ветви М. На основе определения частоты элемента PQQ межгенного локуса COI-COII мтДНК в популяциях пчел на Урале (Средний и Южный Урал) нами было обнаружено четыре резервата пчелы подвида A.m.mellifera – часть некогда единой европейской популяции A.m.mellifera, занимающая ареал от Западной Европы до Уральских гор и представляющая большую ценность для пчеловодства Северной Евразии (Ильясов, 2005).
Анализ нуклеотидной последовательности части гена Nd2 протяженностью 612-633 п.н. в 12 образцах четырех выделенных нами популяций показал незначительную дивергенцию, что подтверждает единство происхождения и родство. Проанализированные нуклеотидные последовательности гена Nd2 пчел уральской популяции были депонированны в генбанк (http://www.ncbi.nlm.nih.gov) под номерами DQ181611-DQ181622. Между нуклеотидными последовательностями гена Nd2 проанализированных образцов наблюдаются транзиции в положениях 35, 120, 360, 514, 546, где транзиция Т>С в положении 35 в образцах DQ181614 и DQ181618 приводит к аминокислотной замене изолейцина Ile на треонин Thr в положении 12. Трансверсий в последовательностях не было обнаружено.
Сравнение проанализированной нами последовательности гена Nd2 уральских образцов с аналогичными последовательностями образцов A.m.mellifera европейских популяций, а также других подвидов A.mellifera (Arias and Sheppard, 1996 - U35743-U35765; Marino et al., 2002 - AY114484- AY136625; Sheppard and Meixner, 2003 - AY136624 - AY136625; Kandemir et al., 2004 - AY618910 - AY618911, AY618919 - AY618920) показало значительное сходство пчел уральской популяции с A.m.mellifera европейских популяций по сравнению с популяциями пчел других подвидов, что доказывает их единство происхождения. При кластерном анализе, используя метод ближнего соседа, наблюдается разделение на три крупные ветви, которые по составу и географическому положению ареалов подвидов соответствовали эволюционным ветвям А, М и С (рис. 1). Ветвь О объединилась с африканской ветвью А, что можно объяснить сильным потоком генов со стороны ветви А. Такая группировка согласуется с результатами предыдущих исследований F.Ruttner (1988), M.C.Arias and W.S.Sheppard (1996), P.Franck et al. (2000) и A.Jensen et al. (2005).
Ветвь А подразделяется на две группы – северо- и южно-африканскую. Такое разделение было вызвано, возможно, географическим барьером, как пустыня Сахара, что привело к длительной изоляции и последующей дивергенции подвидов. Самое большое таксономическое разнообразие наблюдается в ветви С, куда вошли образцы нового подвида A.m.pomonella, что позволяет предположить, что ветвь С была предковой для всех эволюционных ветвей. Ветвь М включает подвиды A.m.ligustica и A.m.sicula, гибридизация которых с A.m.mellifera была показана в работе P.Franck et al. (2000). Образцы A.m.meda входят в группы С и О, а образцы A.m.lamarckii – в группы О и А, что отметили M.C.Arias and W.S.Sheppard (1996) и P.Franck et al. (2000, 2001). Такое распределение подвидов говорит о зонах гибридизации на границах эволюционных ветвей С и О, А и О, соответственно.
Таким образом, на Урале еще сохранилась часть уникальной европейской популяции A.m.mellifera, которая подразделена на четыре субпопуляции, характеризующиеся значительным сходством по материнской линии мтДНК с европейскими популяциями A.m.mellifera. Для успешного сохранения генофонда A.m.mellifera и восстановления его первоначального ареала на Урале необходимо провести более детальное исследование популяций данного региона и обозначить границы резерватов.
To date, the subspecies susceptible to intense hybridization, which was not spared and the population Ammellifera - the main component of the evolutionary branch of M. On the basis of determining the frequency of the element PQQ intergenic locus COI-COII mtDNA in populations of bees in the Urals (Middle and South Urals), we have found four reserve bee subspecies Ammellifera - once part of a single European populations Ammellifera, occupying the area from Western Europe to the Ural Mountains and represents great value for beekeeping in North Eurasia (Ilyasov, 2005).
Nucleotide sequence analysis of the gene Nd2 length 612-633 bp 12 samples of four isolated populations showed us a small divergence, which confirms the common origin and kinship. Analyzed the nucleotide sequence of the gene Nd2 bees Ural population was deposited into the genebank (http://www.ncbi.nlm.nih.gov) under the numbers DQ181611-DQ181622. Between the nucleotide sequences of the gene analyzed samples Nd2 transitions observed at positions 35, 120, 360, 514, 546, where the transitions T> C at position 35 in the samples DQ181614 and DQ181618 causes an amino acid substitution of isoleucine for threonine Thr Ile at position 12 in the sequence transversions It was observed.
Comparison of gene sequences we analyzed Nd2 Ural samples with similar sequences of samples Ammellifera European populations, as well as other subspecies A.mellifera (Arias and Sheppard, 1996 - U35743-U35765; Marino et al., 2002 - AY114484- AY136625; Sheppard and Meixner, 2003 - AY136624 - AY136625; Kandemir et al., 2004 - AY618910 - AY618911, AY618919 - AY618920) showed significant similarity to the Ural population of bees Ammellifera European population compared with the populations of other subspecies of bees, which proves their common origin. When a cluster analysis using the nearest-neighbor method, there is a division into three major branches which the composition and geographical location of areas consistent with an evolutionary subspecies branches A, M and C (Fig. 1). About Branch merged with the African branch A, which can be explained by a strong gene flow from the branch A. Such a grouping is consistent with results of previous studies F.Ruttner (1988), MCArias and WSSheppard (1996), P.Franck et al. (2000) and A.Jensen et al. (2005).
A branch is divided into two groups - the North and South Africa. This separation was caused, perhaps, geographic barriers like the Sahara desert, which led to a long isolation and subsequent divergence subspecies. The greatest taxonomic diversity observed in the branch C, which includes samples of the new subspecies Ampomonella, suggesting that was the ancestral branch with all evolutionary branches. Branch M includes subspecies and Amligustica Amsicula, hybridization with Ammellifera which was shown in the P.Franck et al. (2000). Samples Ammeda come in groups C and D, and samples Amlamarckii - in group G and A, which noted MCArias and WSSheppard (1996) and P.Franck et al. (2000, 2001). This distribution suggests subspecies hybridization areas on the borders of evolutionary branches C and D, A and D, respectively.
Thus, in the Urals, it has preserved a unique part of the European population Ammellifera, which is divided into four sub-population, characterized by considerable similarity maternal mtDNA European populations Ammellifera. In order to successfully preserve the gene pool Ammellifera and restore its original habitat in the Urals is necessary to conduct a more detailed study of the populations of the region and demarcate reserves.
  010. Ильясов Р.А., ПетуховА.В., ПоскряковА.В., НиколенкоА.Г. На Урале сохранились четыре резервата пчелы среднерусской расы Apis mellifera mellifera L.. Пчеловодство. 2006. №2. С. 19.  

На Урале сохранились четыре резервата пчелы среднерусской расы Apis mellifera mellifera L. (In the Urals preserved four population of dark european bee Apis mellifera mellifera L.)
Обнаруженные нами пасеки с высокой частотой аллеля PQQ позволяют говорить о существовании на Урале, как минимум, четырех локальных популяций А. т. mellifera L.: вишерской, южно-прикамской, татышлинской и бурзян- ской. Принадлежность пчел уинской популяции к подвиду А. т. mellifera L. не подтвердилась. Данное утверждение объясняется тем, что либо предварительные морфометрические исследования не позволяли с большой точностью идентифицировать подвиды, что не удивительно при современном уровне гибридизации, либо популяция подверглась гибридизации за время, прошедшее между двумя исследованиями. Найденные нами пасеки с высоким содержанием аллеля PQQ на территории Татышлинского района Республики Башкортостан, — возможно, сохранившаяся часть некогда знаменитой янаульской популяции А. т. mellifera. L.
Таким образом, в ходе популяционно-генетических исследований на Южном и Среднем Урале обнаружены четыре локальные популяции, которые можно охарактеризовать как генетические резерваты А. т. mellifera. L. Это вишерская, южно-прикам- ская, татышлинская и бурзянская популяции, отличающиеся высокой долей встречаемости аллеля PQQ локуса COI-COII мтДНК. В настоящее время наша лаборатория проводит сравнительные популяционно-генетические исследования выделенных популяций.
We found an apiary with a high frequency of allele PQQ suggest the existence of the Urals, at least four local populations of A. m. Mellifera L .: Visherskaya, South-Kama region, and tatyshlinskoy burzyan- tion. Affiliation bees Uinskoye population to the subspecies A. m. Mellifera L. was not confirmed. This statement is explained by the fact that a preliminary morphometric study did not allow a high degree of accuracy to identify subspecies, which is not surprising given the present level of hybridization, or the population has undergone hybridization for the time elapsed between the two studies. We found apiary with high allele PQQ in the territory of the Republic of Bashkortostan Tatyshlinsky District - perhaps remains of the once famous YANAULSKY population of A. m. Mellifera. L.
Thus, in the course of population genetic studies in the South and Middle Urals found four local populations, which can be described as genetic reserves A. m. Mellifera. L. This Visherskaya, South prikam- Skye, tatyshlinskaya and Burzyan population, a high proportion allele PQQ locus COI-COII mtDNA. Currently, our laboratory conducts comparative population genetic studies of populations isolated.
Publication Name: Ilyasov R.A., Petukhov A.V., Poskryakov A.V. Nikolenko A.G. In the Urals preserved four population of dark european bee Apis mellifera mellifera L. Russian journal of beekeeping. 2006. V. 2. P. 19-20.
  011. Ильясов Р.А. Полиморфизм Apis mellifera mellifera L на Урале. Автореферат диссертации на соискание ученой степени кандидата биологических наук. Уфа. 2006. С. 24.  

ПОЛИМОРФИЗМ APIS MELLIFERA MELLIFERA L. НА УРАЛЕ (Polymorphism of Apis mellifera mellifera L. in Ural. Thesis of Ph.D. )
Было показано существование четырёх сохранившихся
локальных популяций A.m.mellifera на Урале на основе полиморфизма межгенного локуса COI-COII мтДНК. Одновременно установлено, что уинская популяция, ранее принимаемая по морфометрическим признакам за популяцию
A.m.mellifera, является гибридной. Анализ генетической структуры уральских популяций A.m.mellifera на основе полиморфизма ядерной и митохондриальной ДНК выявил тесное генетическое родство, небольшую долю инбридинга и дефицит гетерозигот.
Таким образом, было показано, что A.m.mellifera на Урале существует в виде островной генетически неподразделённой популяции. Кроме того, показано генетическое родство уральских и западноевропейских популяций A.m.mellifera. Сравнительным анализом митотипов фрагмента гена ND2 митохондриальной ДНК показано, что подвид A.m.mellifera, вероятно, является
единственным представителем внутривидовой эволюционной ветви М, а предковой формой вида Apis mellifera L. могли быть пчелы эволюционной ветви С.
1.    На основе полиморфизма межгенного локуса COI-COII митохондриальной ДНК показано существование как минимум четырёх сохранившихся локальных популяций Apis mellifera mellifera L. на Урале: вишерской, южно-прикамской, татышлинской и бурзянской.
2.    Анализ частот встречаемости комбинации PQQ межгенного локуса COI-COII мтДНК показал, что уинская популяция, ранее принимаемая по морфометрическим признакам за популяцию A.m.mellifera, является гибридной. Генетическое расстояние между уральской A.m.mellifera и гибридной иглинской популяцией может быть принято в дальнейших исследованиях за один из критериев сохранности аборигенной популяции A.m.mellifera.
3.    Исследование полиморфизма отдельных локусов ядерной и митохондриальной ДНК выявило тесное генетическое родство, небольшую долю инбридинга и дефицит гетерозигот в уральских популяциях A.m.mellifera.
4.    Филогенетический анализ на основе сравнения нуклеотидных последовательностей фрагмента гена ND2 митохондриальной ДНК показал генетическое родство уральских и западноевропейских популяций A.m.mellifera.
5.    Сравнительный анализ митотипов фрагмента гена ND2 митохондриальной ДНК свидетельствует, что подвид A.m.mellifera, вероятно, является единственным представителем внутривидовой эволюционной ветви М, в которую, таким образом, не следует включать не только африканские подвиды Apis mellifera sahariensis Baldensperger и Apis mellifera intermissa Maa, но и испанский подвид Apis mellifera iberica Goetze. Обнаружено, что предковой формой вида Apis mellifera L., могли быть пчелы эволюционной ветви С, а не О, как считалось ранее.
It has been shown the existence of four surviving
Ammellifera local populations in the Urals-based polymorphism intergenic locus COI-COII mtDNA. At the same time found that Uinskoye population, previously hosted on morphometric characteristics of the population
Ammellifera, is a hybrid. Analysis of the genetic structure of populations of the Ural Ammellifera based polymorphism nuclear and mitochondrial DNA revealed a close genetic relationship, a small fraction of inbreeding and the deficit of heterozygotes.
Thus, it was shown that the Ural Ammellifera exists as a genetically nepodrazdelёnnoy island population. Moreover, we show the genetic relationship of the Urals and Western European populations Ammellifera. Comparative analysis of gene fragment mitotypes ND2 mitochondrial DNA shows that subspecies Ammellifera, probably the
the sole representative of intraspecific evolutionary branch of M, and the ancestral form species Apis mellifera L. bees could be evolutionary branch S.
1. On the basis of polymorphism of the intergenic locus COI-COII mitochondrial DNA demonstrated the existence of at least four remaining local populations of Apis mellifera mellifera L. in the Urals: Visherskaya, South-Kama region, and tatyshlinskoy Burzyan.
2. Analysis of the frequency of occurrence of a combination of PQQ intergenic locus COI-COII mtDNA showed that Uinskoye population, previously hosted on morphometric characteristics of the population Ammellifera, is a hybrid. The genetic distance between the Urals and Ammellifera Iglinsky hybrid population can be made for further research in one of the criteria for the preservation of native populations Ammellifera.
3. A study of polymorphism loci separate nuclear and mitochondrial DNA revealed a close genetic relationship, a small fraction of inbreeding and the deficit of heterozygotes in the Urals populations Ammellifera.
4. Phylogenetic analysis based on a comparison of the nucleotide sequences of the gene fragment ND2 mitochondrial DNA showed genetic relatedness of the Urals and Western European populations Ammellifera.
5. Comparative analysis mitotypes ND2 gene fragment of mitochondrial DNA indicates that the subspecies Ammellifera, probably, is the only representative of intraspecific evolutionary branches of M, which, therefore, should not be included not only African subspecies Apis mellifera sahariensis Baldensperger and Apis mellifera intermissa Maa, but Spanish subspecies Apis mellifera iberica Goetze. It was found that the ancestral form of the type Apis mellifera L., could be an evolutionary branch with bees, and not, as previously thought.
Publication Name: Ilyasov R.A. Polymorphism of Apis mellifera mellifera L. in Ural. Thesis of Ph.D. 2006. 24 p.
  012. Ильясов Р.А. Полиморфизм Apis mellifera mellifera L на Урале. Диссертация на соискание ученой степени кандидата биологических наук. Уфа. 2006. С. 204.  

Полиморфизм Apis mellifera mellifera L на Урале. Диссертация (Polymorphism of Apis mellifera mellifera L. in Ural. Thesis of Ph.D). The thesis for the degree of candidate of biological sciences. Preservation of the gene pool of dark forest honey bee Ammellifera is the base point for the development of beekeeping and bee breeding in Russia which in turn requires solving a number of problems in basic and applied research. Our work touches the three of them. We were able to prove the existence of the Urals several genetic reserves that should be the basis for the preservation of the gene pool Ammellifera. It was expanded set of genetic markers and statistical approaches used for this purpose. We It managed to obtain new data on the structure of intra honeybee A.mellifera. We hope that the results will allow to approach the problem of preserving the gene pool Ammellifera both in Russia and in other Nordic countries. As is known, the use morphometric methods for this purpose little information when using hybrid bees. It is shown that by using molecular methods may determine which subspecies belong to the bees. However, not all genetic loci can become markers. Only strict selection and integrated use of nuclear loci and mitochondrial genomes will be effective in the identification of subtypes of bees. Equally important in the study played a statistical analysis of results. Statistical methods, selection of genetic markers and the character of the collection object is strictly dependent on the goals of the study. Phylogenetic analysis also allowed for the first time to establish close genetic kinship bees Ural and European populations Ammellifera. In parallel, we have been able to show that the evolutionary branch of M consists only of subspecies Ammellifera, whereas previously it was thought that it includes several other A.mellifera subspecies of the North-West Africa and the Iberian Peninsula. The obtained genetic characteristics of populations of bees Urals unique and will serve as a basis for further research, as well as measures for the conservation and restoration of the entire gene pool Ammellifera the territory of the former habitat subspecies. Furthermore, based on these data, we can develop a strategy for the further development and management of beekeeping Ammellifera populations in Russia and Europe. On the basis of polymorphism intergenic locus COI-COII mitochondrial DNA demonstrated the existence of at least four stored locally populations of Apis mellifera mellifera L. in the Urals: Vishera, Kama region of the South, tatyshlinskoy and Burzyan. An analysis of the frequency of occurrence of combinations of PQQ intergenic locus COI-COII mtDNA showed that uinskaya population, previously hosted by morphometric featured for the population Ammellifera, it is a hybrid. Genetic distance Ammellifera between the Ural and the hybrid population can be Iglinsky accepted for further studies at one of the criteria for the safety of aboriginal population A.m.mellifera. A study of polymorphism loci separate nuclear and mitochondrial DNA revealed a close genetic relationship, a small fraction of inbreeding and a lack of heterozygotes in the Ural population Ammellifera. Phylogenetic analysis based on a comparison of the nucleotide ND2 gene fragment sequences of mitochondrial DNA revealed genetic kinship of the Ural and Western European populations Ammellifera. Comparative analysis mitotypes gene fragment of the mitochondrial ND2 DNA shows that subspecies Ammellifera, probably the only Representative intraspecific evolutionary branches of M, which is thus not It should include not only the African subspecies Apis mellifera sahariensis Baldensperger and Apis mellifera intermissa Maa, but Spanish subspecies of Apis mellifera iberica Goetze. It found that species ancestral form Apis mellifera L., could be With bee evolutionary branch, and not, as previously thought.
Диссертация на соискание ученой степени кандидата биологических наук. Сохранение генофонда тёмной лесной медоносной пчелы A.m.mellifera являлось базовым моментом для развития пчеловодства и селекции пчел в России, что в свою очередь требует решения целого ряда задач в области фундаментальных и прикладных исследований. Наша работа касалась трёх из них. Нам удалось доказать существование на Урале нескольких генетических резерватов, которые должны стать основой для сохранения генофонда A.m.mellifera. Был расширен комплекс генетических маркёров и статистических подходов, используемых для этого. Нам удалось получить новые данные по внутривидовой структуре медоносной пчелы A.mellifera. Мы надеемся, что полученные результаты позволят приблизиться к решению проблемы сохранения генофонда A.m.mellifera как в России, так и в других странах Северной Европы. Как известно, использование морфометрических методов для этой цели малоинформативно при работе с гибридными пчелами. Показано, что с помощью молекулярных методов возможно определить, к какому подвиду принадлежат пчелы. Тем не менее, не любые локусы могут стать генетическими маркерами. Только строгий подбор и комплексное использование локусов ядерного и митохондриального геномов будет эффективно в идентификации подвидов пчел. Не менее важную роль в исследовании играла статистическая обработка полученных результатов. Методы статистической обработки, подбор генетических маркеров и характер сбора объекта строго зависят от поставленных целей исследования. Также филогенетический анализ позволил впервые установить тесное генетическое родство пчел уральских и европейских популяций A.m.mellifera. Параллельно мы смогли показать, что эволюционная ветвь М состоит только из подвида A.m.mellifera, тогда как раньше считалось, что в нее входят несколько других подвидов A.mellifera из Северо-Западной Африки и Иберийского полуострова. Полученные нами генетические характеристики популяций пчел Урала уникальны и будут служить основой для дальнейших исследований, а также мероприятий по сохранению и восстановлению генофонда A.m.mellifera на всей территории прежнего ареала подвида. Кроме того, на основе этих данных мы можем разработать стратегию дальнейшего развития пчеловодства и управления популяциями A.m.mellifera в России и Европе. На основе полиморфизма межгенного локуса COI-COII митохондриальной ДНК показано существование как минимум четырёх сохранившихся локальных популяций Apis mellifera mellifera L. на Урале: вишерской, южно-прикамской, татышлинской и бурзянской. Анализ частот встречаемости комбинации PQQ межгенного локуса COI-COII мтДНК показал, что уинская популяция, ранее принимаемая по морфометрическим признакам за популяцию A.m.mellifera, являлась гибридной. Генетическое расстояние между уральской A.m.mellifera и гибридной иглинской популяцией может быть принято в дальнейших исследованиях за один из критериев сохранности аборигенной популяции A.m.mellifera. Исследование полиморфизма отдельных локусов ядерной и митохондриальной ДНК выявило тесное генетическое родство, небольшую долю инбридинга и дефицит гетерозигот в уральских популяциях A.m.mellifera. Филогенетический анализ на основе сравнения нуклеотидных последовательностей фрагмента гена ND2 митохондриальной ДНК показал генетическое родство уральских и западноевропейских популяций A.m.mellifera. Сравнительный анализ митотипов фрагмента гена ND2 митохондриальной ДНК свидетельствует, что подвид A.m.mellifera, вероятно, является единственным представителем внутривидовой эволюционной ветви М, в которую, таким образом, не следует включать не только африканские подвиды Apis mellifera sahariensis Baldensperger и Apis mellifera intermissa Maa, но и испанский подвид Apis mellifera iberica Goetze. Обнаружено, что предковой формой вида Apis mellifera L., могли быть пчелы эволюционной ветви С, а не О, как считалось ранее. Publication Name: Ilyasov R.A. Polymorphism of Apis mellifera mellifera L. in Ural. Thesis of Ph.D. 2006. 204 p. 
  013. Ильясов Р.А. Дифференциация популяций медоносной пчелы на Урале. Материалы IX всероссийского популяционного семинара "Особь и популяция – стратегии жизни". Уфа. 2006. С. 176-181.  

Были проанализированы образцы пчел из иглинской популяции – 50 семей и бурзянской популяции – 62 семьи с использованием аллельных вариаций микросателлитного локуса 4а110. В исследуемых популяциях наблюдались два аллеля. В бурзянской популяции аллель 1 встречался с частотой 0,580, а аллель 2 – с частотой 0,420. В иглинской популяции аллель 1 встречался с частотой 0,710, а аллель 2 – с частотой 0,290. Для бурзянской популяции значение коэффициента инбридинга внутри субпопуляции (Fis) по B.S.Weir, C.C.Cockerham (1984) равно 0,213, а иглинской популяции - 0,087. Во взятых для сравнения популяциях Apis mellifera mellifera Colonsay и Whitby в Великобритании, проанализированных A.B.Jensen et al. (2004) с использованием 11 микросателлитных локусов значение внутрипопуляционного инбридинга (Fis) было равно 0,003 и 0,024, соответственно. Положительное и близкое к 0 значение этого коэффициента показывает незначительный дефицит гетерозигот и уровень инбридинга. В бурзянской популяции наблюдаемая гетерозиготность Hо = 0,387, а ожидаемая гетерозиготность He = 0,609. В иглинской популяции наблюдаемая гетерозиготность Hо = 0,380, а ожидаемая гетерозиготность He = 0,416. Как мы видим в бурзянской популяции, по результатам анализа данного локуса, наблюдается больший инбридинг и дефицит гетерозигот по сравнению с иглинской популяцией и популяциями Великобритании, в которых этот коэффициент максимально приближен к 0, что констатирует минимальное отклонении от равновесия по Харди-Вайнбергу. В бурзянской популяции это может быть следствием продолжительной изоляции в горно-лесной географической зоне. Коэффициент дифференциации популяций (Fst) по B.S.Weir, C.C.Cockerham (1984) между бурзянской и иглинской популяциями 0,025. Для сравнения, коэффициент дифференциации популяций (Fst), при анализе с использованием 11 микросателлитных локусов, между популяциями Apis mellifera mellifera Colonsay и Whitby Великобритании 0,055. Отсюда видно, что дифференциация уральских популяций по результатам анализа данного локуса значительно ниже дифференциации популяций Великобритании при мультилокусном анализе. Точный тест Фишера (Р), оценивающий генную дифференциацию между бурзянской и иглинской популяциями P = 0,051, а величина χ2 = 5,907. Точный тест Фишера (Р), оценивающий генотипическую дифференциацию между бурзянской и иглинской популяциями Р = 0,069, а величина χ2 = 5,337. Отсюда можно заключить, что между бурзянской и иглинской популяциями наблюдается незначительная дифференциация на генном и генотипическом уровнях (P ≥ 0,05). Рассчитанная стандартная генетическая дистанция M.Nei (1972) (Ds) между иглинской и бурзянской популяциями равна 0,029, а генетическая дистанция L.L.Cavalli-Sforza, A.W.F.Edwards (1967) (Dce) между бурзянской и иглинской популяциями была равна 0,086. Для сравнения, генетическая дистанция M.Nei (1978) расчитанная F.J.Ayala (1975), используя аллельные вариации 28 кодирующих белок генов, между локальными популяциями Drosophila willistoni была равна 0,031, между локальными популяциями рыб - 0,020, между локальными популяциями беспозвоночных - 0,016. Кроме того, стандартная генетическая дистанция M.Nei (1978) между островными популяциями Apis mellifera в Германии, расчитанная P.Neumann et al. (1999), используя 4 микросателлитных локуса, между матками пчел популяций Baltrum и Langeoog была равна 0,029, а между трутнями - 0,436. Как мы видим, уровень дифференциации трутней выше уровня дифференциации маток. Генетическая дистанция L.L.Cavalli-Sforza, A.W.F.Edwards (1967), рассчитанная K.E.Clarke et al. (2002), используя 6 микросателлитных локусов, между популяциями Apis mellifera ligustica из Италии и A.m.carnica из Югославии равна 0,510, а между популяциями Apis mellifera ligustica из Италии и Apis mellifera mellifera из Франции равна 0,680. Таким образом, по данному локусу уральские популяции различаются между собой, как локальные популяции, тогда как между европейскими популяциями пчел наблюдаются большие значения генетического расстояния, что характеризует большую дифференциацию европейских популяций по сравнению с уральскими.
Таким образом, была показана генетическая вариабельность микросателлитного локуса 4а110 в уральских популяциях и показана дифференциация между иглинской и бурзянской популяциями. Несмотря на то, что наблюдаются четкие различия на уровне митохондриальной (локус COI-COII) и ядерной ДНК (микросателлитный локус 4а110), все же уровень дифференциации между уральскими популяциями низок. Такая незначительная дифференциация между гибридной и местной популяциями, по результатам анализа с использованием одного микросателлитного локуса 4а110, может иметь несколько объяснений. Во-первых, возможно, что это результат потока генов из бурзянской популяции в иглинскую. Во-вторых, возможно, что частота аллелей этого локуса в иглинской популяции не сильно изменилась в результате гибридизации с Apis mellifera caucasica. В-третьих, один локус не всегда может быть адекватным в изучении и сравнении популяций. Дальнейшая наша задача – проанализировать уральские популяции и популяции пчел прилежащих регионов с использованием большего количества ДНК маркеров.
We analyzed samples of bees from Iglinsky population - 50 families and Burzyan population - 62 families with allelic variations of microsatellite loci 4a110. The study populations were observed two alleles. In Burzyan population allele frequency of 1 met with 0,580, and allele 2 - with the frequency of 0.420. In Iglinsky population allele frequency of 1 met with 0.710, and allele 2 - with the frequency of 0.290. For Burzyan population coefficient of inbreeding within the subpopulation (Fis) for BSWeir, CCCockerham (1984) is equal to 0.213, and Iglinsky population - 0,087. When taken to compare populations Apis mellifera mellifera Colonsay and Whitby in the UK, analyzed ABJensen et al. (2004) using 11 microsatellite loci value intrapopulation inbreeding (Fis) was equal to 0.003 and 0.024, respectively. Positive and close to 0 value of this index shows a slight deficit of heterozygotes and the level of inbreeding. In Burzyan population observed heterozygosity = 0.387 But, as expected heterozygosity He = 0,609. In Iglinsky population observed heterozygosity = 0.380 But, as expected heterozygosity He = 0,416. As we see in Burzyan population, according to the analysis of this locus, there is a greater inbreeding and a lack of heterozygotes compared with Iglinsky populations and populations of the UK, where this ratio is as close to 0, which establishes the minimum deviation from equilibrium of Hardy-Weinberg equilibrium. In Burzyan population this may be due to prolonged isolation in the mountain forest geographical area. Coefficient of population differentiation (Fst) of BSWeir, CCCockerham (1984) Burzyan between 0,025 and Iglinsky populations. For comparison, the coefficient of population differentiation (Fst), when analyzed using 11 microsatellite loci between populations Apis mellifera mellifera Colonsay and Whitby UK 0,055. This shows that the differentiation of the Ural population according to the analysis of the locus of much lower differentiation of populations in the UK multipoint analysis. Fisher's exact test (P), estimating genetic differentiation between populations Iglinsky Burzyan and P = 0,051, and the value of χ2 = 5,907. Fisher's exact test (P), estimating genotypic differentiation between populations Iglinsky Burzyan and P = 0.069, and the value of χ2 = 5,337. From this we can conclude that between Burzyan and Iglinsky populations observed slight differentiation at the genetic and genotypic levels (P ≥ 0,05). The standard genetic distance M.Nei (1972) (Ds) between Iglinsky and Burzyan populations is 0.029 and the genetic distance LLCavalli-Sforza, AWFEdwards (1967) (Dce) between Burzyan and Iglinsky populations was equal to 0.086. For comparison, the genetic distance M.Nei (1978) calculate FJAyala (1975), using the allelic variations of 28 protein-coding genes between local populations of Drosophila willistoni was equal to 0.031, between local populations of fish - 0,020 between local populations of invertebrates - 0,016. In addition, the standard genetic distance M.Nei (1978) among island populations of Apis mellifera in Germany calculate P.Neumann et al. (1999), using four microsatellite loci between populations of bees queens Baltrum and Langeoog was equal to 0.029, but between drones - 0.436. As we can see, the level of differentiation of drones above the differentiation of queens. Genetic distance LLCavalli-Sforza, AWFEdwards (1967), calculated KEClarke et al. (2002), using 6 microsatellite loci between populations Apis mellifera ligustica from Italy and from Yugoslavia Amcarnica equal to 0.510, and between the populations of Apis mellifera ligustica from Italy and Apis mellifera mellifera from France is 0.680. Thus, according to the locus of the Ural population differ among themselves as local populations, whereas between the populations of European bee observed large genetic distance values ​​that characterizes the greater differentiation European populations compared with Ural.
Thus, the genetic variability has been shown 4a110 microsatellite loci in the Ural population and shows the differentiation between Iglinsky and Burzyan populations. Despite the fact that there are clear differences in the level of mitochondrial (locus COI-COII) and nuclear DNA (microsatellite loci 4a110), yet the level of differentiation between the Ural population is low. This slight differentiation between hybrid and local populations, according to the analysis using one microsatellite locus 4a110 may have several explanations. Firstly, it is possible that this is the result of gene flow from Burzyan population Iglinskiy. Secondly, it is possible that the frequency of alleles at this locus in Iglinsky population has not changed much as a result of hybridization Apis mellifera caucasica. Third, one locus may not always be adequate in the study and compared populations. Further, our task - to analyze the Ural population and the population of bees surrounding regions using more DNA markers.
  014. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Эволюция медоносной пчелы Apis mellifera L. Материалы международной конференции "Current Evolutionary Thinking in Biology, Medicine and Sociology". Новосибирск. 2007. С. 55-56.

Apis mellifera имеет необычайно огромный естественный ареал распространения, который простирается от юга Скандинавского полуострова на севере до мыса Доброй Надежды на юге; от Дакара на западе до Алтая, Маскада и западных границ Китая на востоке (Ruttner et al., 1978; Sheppard, Meixner, 2003). Ранее с использованием мультивариантного анализа морфометрических признаков было определено существование 25 подвидов пчел (Ruttner, 1992). Современная номенклатура, основанная на молекулярных данных, подтверждает предыдущие результаты, но с некоторой поправкой на состав подвидов.
Как выяснилось, для получения окончательной филогенетической структуры и определения структуры эволюционной ветви М, в частности статуса подвида A.m.mellifera, недоставало нескольких образцов из уже ранее известных чистых линий на Урале. Поэтому для филогенетического анализа были использованы пчелы подвида A.m.mellifera из бурзянской и татышлинской популяций республики Башкортостан (DQ181611-DQ181622) и вишерской и южно-прикамской популяций Пермского края (DQ361088-DQ361090), которые были ранее выделены нами на основе изучения полиморфизма межгенного локуса COI-COII мтДНК (Ильясов с соавт., 2006). Также были использованы пчелы из украинской популяции с пасеки под Киевом, любезно предоставленные А.Д.Комиссаром. Для сравнения были использованы нуклеотидные последовательности фрагмента гена ND2 мтДНК других подвидов A.mellifera. Для укоренения филогенетическго построения были использованы последовательности пчел другого вида - Apis cerana и другого рода - Mellipona bicolor.
На основе сравнения нуклеотидных последовательностей была построена дендрограмма с использованием программы MEGA 3.1 и метода кластеризации ближайшего соседа и медианная сеть (Bandelt, Dress, 1992; Makarenkov, Legendre, 2004) с использованием программы NETWORK. В качестве референсной была использована нуклеотидная последовательность фрагмента ND2 мтДНК подвида A.m.anatoliaca. На дендрограмме и медианной сети наблюдалось разделение на четыре группы, названные эволюционными ветвями А, О, М и С.
Эволюционная ветвь А объединила в основном представителей африканских подвидов пчел. Она подразделялась на две группы, одна из которых объединила большинство африканских подвидов пчел к югу от Сахары и африканизированных пчел из Бразилии. Другая группа объединила северо-африканские, а также несколько сридеземноморских подвидов, что можно объяснить гибридизацией пчел Сицилии. Кроме того, в этой эволюционной ветви выделяется еще одна небольшая группа африканских пчел, объединяющая представителей подвидов из Кении и Сенегала.
Эволюционная ветвь О объединила представителей подвидов A.m.meda и A.m.syriaca из Сирии и A.m.lamarckii из Египта. M.C.Arias, W.S.Sheppard (1996), P.Franck et al. (2000) в своих работах также отнесли подвид A.m.lamarckii к эволюционной ветви О, тогда как ранее F.Ruttner et al. (1988) относил к эволюционной ветви А.
Эволюционная ветвь М состояла в основном из представителей A.m.mellifera уральских и европейских популяций из Швейцарии, Франции, Испании и Норвегии. Однако в эту группу также вошли по два представителя подвидов A.m.sicula с Сицилии и A.m.ligustica из Италии, что может быть объяснено их гибридизацией с A.m.mellifera. По нашим данным A.m.mellifera является единственным представителем эволюционной ветви М..
Эволюционная ветвь С представлена наиболее многочисленно по числу подвидов и объединяла подвиды пчел Средиземноморья, Ближнего Востока и Кавказа. Здесь наиболее выделялась огромная центральная группа, которая, возможно, является точкой экспансии подвидов.
Использование в сравнении последовательностей фрагмента гена ND2 мтДНК пчел из рода Mellipona, который очень рано дивергировал от предков рода Apis, позволило заключить, что пчелы видов Apis mellifera и Apis cerana являются по отношению сестринскими видами.
Путем сравнения нуклеотидных последовательностей фрагмента гена ND2 мтДНК всех образцов пчел с использованием программы DNASTAR были рассчитаны проценты различий между Mellipona bicolor и каждым из видов рода Apis – A.mellifera и A.cerana, которые были равны 22,18% и 23,02%, соответственно. Между A.mellifera и A.cerana процент различий был равен 15,54%. DeSalle et al. (1987) в своей работе показали для Drosophila, что различия нуклеотидной последовательности мтДНК в 2% соответствует времени дивергенции в 1 миллион лет, что было использовано применительно ко времени дивергенции пчел M.C.Arias, W.S.Sheppard (1996, 2005). Учитывая данную скорость дивергенции мы рассчитали время дивергенции, которое между Mellipona bicolor и A.mellifera равно 11,09 млн. лет, между Mellipona bicolor и A.cerana равно 11,5 млн.лет, а между A.mellifera и A.cerana равна 7,77 млн. лет. Виды A.mellifera и A.cerana дивергировали от Mellipona bicolor в среднем 11,3 млн. лет назад. Виды A.mellifera и A.cerana, возможно, дивергировали от общего предка в среднем 3,89 млн. лет назад, где A.cerana на 0,42 млн. лет раньше отделилась от общего предка, следовательно A.mellifera имеет возраст 3,47 млн. лет, а A.cerana – 4,31 млн. лет.
Таким образом, проведенные нами исследования показали высокую степень генетического родства уральских и западноевропейских популяций A.m.mellifera - единственных представителей эволюционной ветви М. Показано, что предковой формой вида Apis mellifera L. могут являться пчелы эволюционной ветви С. Результат анализа украинских пчел, подтвердил их принадлежность к подвиду A.m.macedonica. Пчелы A.cerana и A.mellifera по нашим данным являются сетринскими видами по отношению друг к другу.
Apis mellifera has an unusually huge natural area of ​​distribution that extends from the south of Scandinavia in the north to the Cape of Good Hope in the south; Dakar on the west to the Altai Maskada and western borders of China to the east (Ruttner et al., 1978; Sheppard, Meixner, 2003). Previously, using a multivariate analysis of morphometric characteristics it was determined the existence of 25 subspecies of bees (Ruttner, 1992). The modern nomenclature, based on the molecular data confirms the previous results, but with some amendments to the composition of the subspecies.
As it turned out, for the final determination of the phylogenetic structure and evolutionary branch structure of M, in particular the status of the subspecies Ammellifera, missing several samples of previously known pure lines in the Urals. Therefore, for the phylogenetic analysis were used bee subspecies of Ammellifera Burzyan and tatyshlinskoy population of the republic of Bashkortostan (DQ181611-DQ181622) and Vishera and southern populations of Kama region of Perm Krai (DQ361088-DQ361090), which were previously allocated on the basis of our study of polymorphism of the intergenic locus COI- COII mtDNA (Ilyasov et al., 2006). Bees were also used from the Ukrainian population from the apiary near Kiev, courtesy A.D.Komissarom. For comparison, we used the nucleotide sequences of mtDNA gene fragment ND2 other subspecies A.mellifera. For rooting filogeneticheskgo were used for constructing the sequence of another species of bees - Apis cerana another kind - Mellipona bicolor.
Based on a comparison of the nucleotide sequences was constructed dendrogram using the program MEGA 3.1 and the nearest neighbor clustering method and Media Network (Bandelt, Dress, 1992; Makarenkov, Legendre, 2004) using the program NETWORK. As reference was used nucleotide sequence fragment ND2 mtDNA subspecies Amanatoliaca. In the dendrogram and media networks division was observed in four groups, called evolutionary branch A, O, M and S.
Evolutionary branch A united mainly of African subspecies of bees. It is divided into two groups, one of which joined the majority of the African subspecies of bees in sub-Saharan and Africanized bees in Brazil. Another group has united North African, as well as several sridezemnomorskih subspecies, which can be explained by hybridization bees Sicily. In addition, in this evolutionary branch stands another small group of African bees, uniting representatives of subspecies from Kenya and Senegal.
On the evolutionary branch brought together representatives of subspecies and Ammeda Amsyriaca Amlamarckii from Syria and Egypt. M.C.Arias, W.S.Sheppard (1996), P.Franck et al. (2000) in his work as a subspecies Amlamarckii attributed to evolutionary branch O, whereas previously F.Ruttner et al. (1988) refers to the evolutionary branch A.
The evolutionary branch of M consisted mainly of representatives Ammellifera Ural and European populations from Switzerland, France, Spain and Norway. However, this group also includes two representatives from the subspecies Amsicula Amligustica Sicily and in Italy that can be explained by their hybridization to Ammellifera. According to our data Ammellifera the sole representative of the evolutionary branch of M ..
With evolutionary branch is represented by the most plentiful in the number of sub-species and sub-species of bees unite the Mediterranean, the Middle East and the Caucasus. Here, the most by huge central group, which may be the point of expansion subspecies.
Using the comparison of sequences of mtDNA gene fragment ND2 bees of the genus Mellipona, which is very early ancestors diverged from the genus Apis, allowed to conclude that the bee species Apis mellifera and Apis cerana are against sister species.
By comparing the nucleotide sequences of mtDNA gene fragment ND2 all samples bees using DNASTAR software percentages were calculated differences between Mellipona bicolor and each of the species of the genus Apis - A.mellifera and A.cerana, which were equal to 22.18% and 23.02%, respectively. Between A.mellifera and A.cerana percentage difference was equal to 15.54%. DeSalle et al. (1987) showed in his work for Drosophila, the differences in the nucleotide sequence of mtDNA 2% corresponds to the time of divergence of 1 million years, which has been used in relation to the time of divergence of bees MCArias, WSSheppard (1996, 2005). Given this divergence, we calculated the rate of divergence time, which is between Mellipona bicolor and A.mellifera still 11,090,000. Years between Mellipona bicolor and A.cerana equal to 11.5 million years, and between A.mellifera and is A.cerana 7770000. years. Forms and A.mellifera A.cerana diverged from Mellipona bicolor average 11.3 mln. Years ago. Forms and A.mellifera A.cerana, may have diverged from a common ancestor by an average 3.89 million. Years ago where A.cerana to 0.42 million. Years earlier separated from a common ancestor, so A.mellifera is age 3, 47 mln. years and A.cerana - 4,31 Mill. years.
Thus, our studies have shown a high degree of genetic relatedness of the Urals and Western European populations Ammellifera - the only representatives of the lineage M. shown that the ancestral form of the species Apis mellifera L. bees may be the evolutionary branch C. The analysis result Ukrainian bees, confirmed that they belong to subspecies Ammacedonica. Bees A.cerana A.mellifera and our data are setrinskimi views with respect to each other.
  015. Колбина Л.М., Непейвода С.Н., Ильясов Р.А., Поскряков А.В., Николенко А.Г. Использование морфологических и молекулярно-генетических методов для исследования Apis mellifera. Аграрная наука Евро-Северо-Востока. № 10. С. 57-58. 2007.  

Для определения породной принадлежности пчел с помощью молекулярногенетических нами был использован полиморфизм межгенного локуса COI-COH митохондриальной ДНК (мтДНК), комбинация PQQ которого характеризует происхождение пчел от A.m.mellifera по материнской линии. Из морфологических методов в наибольшем объеме использовались морфометрические признаки (длина хоботка, кубитальный' и тарзальный индексы, ширина третьего тергита, дис- коидальное смещение). Всего было проанализировано 63 семьи пчел с 11 пасек из 6 районов республики.
Результаты молекулярно-генетических исследований показали, что на большинстве пасек преобладали семьи, имеющие происхождение от A.m. mellifera. Частота комбинации PQQ была высокой (>0,95) на некоторых пасеках Можгинского и Завьяловского районов, а в большинстве других районов наблюдалась довольно низкая частота комбинации PQQ (<0,70), что свидетельствует о завозе пчел южных подвидов (табл. 1). Изучение морфометрических признаков в целом показало большую гибридизацию и изменчивость пчелиных семей. Преобладающее количество среднерусских пчел наблюдалось в Можгинском районе, в остальных процент семей среднерусской породы крайне низок.
Результаты молекулярно-генетического и морфологического методов более чем на 66% совпали в Можгин- ском районе, а в Шарканском оказались диаметрально противоположны. Это по- зволяет с уверенностью судить только об одной выявленной популяции среднерусской породы пчел в Можгинском районе, во всех остальных пчелы сильно гибридизированны южными породами Проведенные исследования показали также, что ни один из использованных методов не стоит абсолютизировать. Поскольку аборигенными пчелами для всего Поволжья, в том числе и Удмуртской Республики, были среднерусские пчелы, то есть пчелы Apis mellifera melli- fera L, а завезенные семьи южных пород составляли небольшой процент от общего количества разводимых пчел, это привело к тому, что большая часть гибридизации местных пчел произошла по мужской линии, которую использованная молекулярно-генетическая методика, к сожалению, учесть не может. С другой стороны, большая вариабельность морфологических признаков, появившаяся в результате гибридизации привела к тому, что часть помесных пчел может по экстерьеру соответствовать среднерусской породе, таковой, по сути, не являясь. Поэтому достоверные результаты могут быть получены только при использовании как морфологических, так и молекулярногенетических методов исследования.
To determine the breed of bees using molekulyarnogeneticheskih we used polymorphism of the intergenic locus COI-COH mitochondrial DNA (mtDNA), which is characterized by a combination of PQQ origin of bees from Ammellifera maternal. From morphological methods were used in the greatest amount of morphometric features (proboscis, cubital 'and tarsal index, the width of the third tergite disk koidalnoe offset). There were analyzed 63 bee colonies from 11 apiaries of 6 regions of the republic.
The results of the molecular genetic studies have shown that in most apiaries dominated family, originating from the Am mellifera. Frequency combination PQQ was high (> 0.95) in some apiaries Mozhginsky and Zavyalovsky areas, and in most other areas, there is quite a low frequency combination PQQ (<0,70), indicating that the importation of bees southern subspecies (Table. 1). The study of morphometric characters in general showed great variability, hybridization and bee colonies. The vast number of Central Russian bees was observed in Mozhginsky area, the percentage of families in the rest of Central Russian breed is extremely low.
The results of molecular genetic and morphological methods for more than 66% in matched Mozhgin- Raion, and Sharkan appeared diametrically opposed. This makes it possible to judge with certainty only one of the identified populations of Central Russian breed of bees in Mozhginsky area in all other bee species strongly hybridized Southern Studies also showed that none of the methods used is not absolute. Since the native bees for the whole Volga region, including the Republic of Udmurtia were Central Russian bees, ie bee Apis mellifera melli- fera L, a southern family imported breeds were a small percentage of the total farmed bees, this has led to the fact that most of the hybridization of native bees occurred in the male line, which used molecular genetic techniques, unfortunately, can not be taken into account. On the other hand, a large variability of morphological characters that appeared as a result of hybridization has led to the fact that part of the hybrid bees can match the exterior of the Central Russian breed, per se, in fact, not being. Therefore, accurate results can be obtained only when using both morphological and molekulyarnogeneticheskih methods.
  016. lyasov R.A., Petukhov A.V., Poskryakov A.V., Nikolenko A.G. Local honeybee (Apis mellifera mellifera L.) populations in the Urals. Russian Journal of Genetics. 2007. V. 43. No. 6. P. 709-711.  

Local honeybee (Apis mellifera mellifera L.) populations in the Urals The COI-COII intergenic region of mitochondrial DNA (mtDNA) was studied in local honeybee ( Apis mellifera mellifera ) L. populations from the Middle and Southern Urals. Analysis of bee colonies in these regions revealed apiaries enriched in families descending from A. m. mellifera in the maternal lineage. These results confirm the suggestion of preservation of A. m. mellifera refuges in the Urals and provide grounds for work on the preservation of the gene pool of this bee variety, valuable for all Russia. Publication Name: Ilyasov R.A., Petukhov A.V., Poskryakov A.V., Nikolenko A.G. Local honeybee (Apis mellifera mellifera L.) populations in the Urals. Russian Journal of Genetics. 2007. V. 43 (6). P. 709-711. 
  017. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Локальные популяции медоносной пчелы подвида Apis mellifera mellifera L. на Урале. Материалы международной конференции "Досягнення i проблеми генетики, селкциii та бiотехнологii". Киев. 2007. Т. 1. С. 231-235.  

Нами было показано существование четырёх сохранившихся локальных популяций Apis mellifera mellifera L. на Урале: вишерской, южно-при- камской, татышлинской и бурзянской. Исследование полиморфизма отдельных локусов ядерной и митохондриальной ДНК выявило тесное генетическое родство, инбридинг и дефицит гетерозигот в уральских популяциях A.m.mellifera. Филогенетический анализ по локусу мтДНК показал генетическое родство уральских и западноевропейских популяций A.m.mellifera. Возможно, что подвид A.m.mellifera является единственным представителем внутривидовой эволюционной ветви М, а предковой формой подвидов Apis mellifera L. могут быть пчелы эволюционной ветви С.
We have shown the existence of the four remaining local populations of Apis mellifera mellifera L. in the Urals: Vishera, South Examples Kamsky tatyshlinskoy and Burzyan. A study of polymorphism loci separate nuclear and mitochondrial DNA revealed a close genetic relationship, inbreeding and a lack of heterozygotes in the Ural population Ammellifera. Phylogenetic analysis of mtDNA locus showed the genetic relationship of the Urals and Western European populations Ammellifera. Perhaps Ammellifera subspecies is the only representative of intraspecific evolutionary branches of M and the ancestral form of the subspecies Apis mellifera L. bees may be evolutionary branch C.
  018. Ильясов Р.А., ПетуховА.В., ПоскряковА.В., НиколенкоА.Г. Локальные популяции Apis mellifera mellifera L. на Урале. Генетика. 2007. №43 (6). С. 855-858.

Локальные популяции Apis mellifera mellifera L. на Урале (Local populations of Apis mellifera mellifera L. in the Urals) Межгенный регион COI-COII митохондриальной ДНК (мтДНК) медоносной пчелы был использован для получения сведений о сохранившихся локальных популяциях Apis mellifera mellifera L. на территории Среднего и Южного Урала. В результате анализа пчелиных семей этого региона были обнаружены пасеки с большой долей встречаемости семей, имеющих происхождение от А. т. mellifera по материнской линии. Результаты этой работы подтверждают предположения о сохранении резерватов А. т. mellifera на Урале и одновременно являются начальным этапом работ по сохранению генофонда этого ценного для всей России подвида пчелы. Intergenic region COI-COII mitochondrial DNA (mtDNA) of the honey bee has been used for information about the safety of local populations Apis mellifera mellifera L. on territory of Central and Southern Urals. An analysis of bee colonies in the region were found apiary with a high degree of occurrence of families with origins from A. m. mellifera through the maternal line. The results of this study confirm the assumption of maintaining Reserves A. m. mellifera in the Urals and at the same time are the initial stage of work on this valuable gene pool for the entire Russian bee subspecies. Publication Name: Ilyasov R.A., Petukhov A.V., Poskryakov A.V. Nikolenko A.G. Local populations of Apis mellifera mellifera L. in the Urals. Russian Journal of Genetics. 2007. V.43 (6), P. 855-858. 
  019. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Митохондриальная ДНК в эволюционных исследованиях пчел. Материалы школы-семинара молодых ученых Уфимского научного центра РАН и Волго-Уральского региона по физико-химической биологии и биотехнологии "Биомика – наука XXI века". Уфа. 2007. С. 52-54.

Apis mellifera имеет необычайно огромный естественный ареал распространения, который простирается от юга Скандинавского полуострова на севере до мыса Доброй Надежды на юге; от Дакара на западе до Алтая, Маскада и западных границ Китая на востоке [9]. Ранее с использованием мультивариантного анализа морфометрических признаков было определено существование 25 подвидов пчел [8].
В нашей работе были использованы пчелы подвида A.m.mellifera из бурзянской и татышлинской популяций республики Башкортостан (DQ181611-DQ181622) и вишерской и южно-прикамской популяций Пермского края (DQ361088-DQ361090), которые были ранее выделены нами на основе изучения полиморфизма межгенного локуса COI-COII мтДНК [1]. Также были использованы пчелы из украинской популяции с пасеки под Киевом, любезно предоставленные А.Д.Комиссаром. Для проведения секвенционного анализа было взято по три образца из описанных выше популяций. Для сравнения были использованы нуклеотидные последовательности фрагмента гена ND2 мтДНК других подвидов A.mellifera. Для укоренения филогенетического построения были использованы последовательности пчел другого вида - Apis cerana и другого рода - Mellipona bicolor.
На основе сравнения нуклеотидных последовательностей была построена дендрограмма с использованием программы MEGA 3.1 и метода кластеризации ближайшего соседа и медианная сеть [4] с использованием программы NETWORK. В качестве референсной была использована нуклеотидная последовательность фрагмента ND2 мтДНК подвида A.m.anatoliaca.
На дендрограмме и медианной сети наблюдалось разделение на четыре группы, названные эволюционными ветвями А, О, М и С. Эволюционная ветвь А объединила большинство представителей африканских подвидов пчел. Она подразделялась на две группы, одна из которых объединила большинство африканских подвидов пчел к югу от Сахары и африканизированных пчел из Бразилии. Другая группа объединила северо-африканские, а также несколько сридеземноморских подвидов, что можно объяснить гибридизацией пчел Сицилии. Кроме того, в этой эволюционной ветви выделяется еще одна небольшая группа африканских пчел, объединяющая представителей подвидов из Кении и Сенегала.
Эволюционная ветвь О объединила представителей подвидов A.m.meda и A.m.syriaca из Сирии и A.m.lamarckii из Египта. Ранее [2, 6] подвид A.m.lamarckii также был отнесен к эволюционной ветви О, тогда как другие [7] относили его к эволюционной ветви А.
Эволюционная ветвь М состояла в основном из представителей A.m.mellifera уральских и европейских популяций из Швейцарии, Франции, Испании и Норвегии. Однако в эту группу также вошли по два представителя подвидов A.m.sicula с Сицилии и A.m.ligustica из Италии, что может быть объяснено их гибридизацией с A.m.mellifera.
Эволюционная ветвь С представлена наиболее многочисленно по числу подвидов и объединяла подвиды пчел Средиземноморья, Ближнего Востока и Кавказа. Здесь наиболее выделялась огромная центральная группа, которая является точкой экспансии подвидов.
Использование в сравнении последовательностей фрагмента гена ND2 мтДНК пчел из рода Mellipona, который очень рано дивергировал от предков рода Apis, позволило заключить, что пчелы видов Apis mellifera и Apis cerana являются по отношению сестринскими видами.
Путем сравнения нуклеотидных последовательностей фрагмента гена ND2 мтДНК всех образцов пчел с использованием программы DNASTAR были рассчитаны проценты различий между Mellipona bicolor и каждым из видов рода Apis – A.mellifera и A.cerana, которые были равны 22,18% и 23,02%, соответственно. Между A.mellifera и A.cerana процент различий был равен 15,54%. Для Drosophila было показано [5], что различия нуклеотидной последовательности мтДНК в 2% соответствует времени дивергенции в 1 миллион лет, что было использовано в некоторых работах применительно ко времени дивергенции пчел [2, 3]. Учитывая данную скорость дивергенции мы рассчитали время дивергенции, которое между Mellipona bicolor и A.mellifera равно 11,09 млн. лет, между Mellipona bicolor и A.cerana равно 11,5 млн.лет, а между A.mellifera и A.cerana равна 7,77 млн. лет. Виды A.mellifera и A.cerana дивергировали от Mellipona bicolor в среднем 11,3 млн. лет назад. Виды A.mellifera и A.cerana, возможно, дивергировали от общего предка в среднем 3,89 млн. лет назад, где A.cerana на 0,42 млн. лет раньше отделилась от общего предка, следовательно A.mellifera имеет возраст 3,47 млн. лет, а A.cerana – 4,31 млн. лет.
Мы показали высокую степень генетического родства уральских и западноевропейских популяций A.m.mellifera - единственных представителей эволюционной ветви М.
Apis mellifera has an unusually huge natural area of ​​distribution that extends from the south of Scandinavia in the north to the Cape of Good Hope in the south; Dakar on the west to the Altai Maskada and western borders of China to the east. [9] Previously, using multivariate analysis of morphometric characters was determined the existence of 25 subtypes of bees. [8]
In our work we used bee subspecies of Ammellifera Burzyan tatyshlinskoy populations and the Republic of Bashkortostan (DQ181611-DQ181622) and Visherskaya Kama region and southern populations of the Perm Territory (DQ361088-DQ361090), which were previously allocated on the basis of our study of polymorphism of the intergenic locus COI-COII mtDNA [1]. Bees were also used from the Ukrainian population from the apiary near Kiev, courtesy A.D.Komissarom. To perform the analysis were taken sekventsionnogo three specimens of the above described populations. For comparison, we used the nucleotide sequences of mtDNA gene fragment ND2 other subspecies A.mellifera. For rooting phylogenetic sequence were used another type of bee - Apis cerana another kind - Mellipona bicolor.
Based on a comparison of the nucleotide sequences of the dendrogram was constructed using MEGA 3.1 program and the nearest neighbor clustering method and median net [4] using the program NETWORK. As reference was used nucleotide sequence fragment ND2 mtDNA subspecies Amanatoliaca.
In the dendrogram and media networks division was observed in four groups, called evolutionary branch A, O, M and S. evolutionary branch A united the majority of the African subspecies of bees. It is divided into two groups, one of which joined the majority of the African subspecies of bees in sub-Saharan and Africanized bees in Brazil. Another group has united North African, as well as several sridezemnomorskih subspecies, which can be explained by hybridization bees Sicily. In addition, in this evolutionary branch stands another small group of African bees, uniting representatives of subspecies from Kenya and Senegal.
On the evolutionary branch brought together representatives of subspecies and Ammeda Amsyriaca Amlamarckii from Syria and Egypt. Earlier [2, 6] Amlamarckii subspecies has also been attributed to the evolutionary branch about, while others [7] attributed it to the evolutionary branch A.
The evolutionary branch of M consisted mainly of representatives Ammellifera Ural and European populations from Switzerland, France, Spain and Norway. However, this group also includes two representatives from the subspecies Amsicula Amligustica Sicily and in Italy that can be explained by their hybridization to Ammellifera.
With evolutionary branch is represented by the most plentiful in the number of sub-species and sub-species of bees unite the Mediterranean, the Middle East and the Caucasus. Here, the most by huge central group, which is the point of expansion subspecies.
Using the comparison of sequences of mtDNA gene fragment ND2 bees of the genus Mellipona, which is very early ancestors diverged from the genus Apis, allowed to conclude that the bee species Apis mellifera and Apis cerana are against sister species.
By comparing the nucleotide sequences of mtDNA gene fragment ND2 all samples bees using DNASTAR software percentages were calculated differences between Mellipona bicolor and each of the species of the genus Apis - A.mellifera and A.cerana, which were equal to 22.18% and 23.02%, respectively. Between A.mellifera and A.cerana percentage difference was equal to 15.54%. For Drosophila showed [5] that the differences in the nucleotide sequence obtained corresponds to 2% divergence time of 1 million years, were used in some work in relation to the time of the divergence of bees [2, 3]. Given this divergence, we calculated the rate of divergence time, which is between Mellipona bicolor and A.mellifera still 11,090,000. Years between Mellipona bicolor and A.cerana equal to 11.5 million years, and between A.mellifera and is A.cerana 7770000. years. Forms and A.mellifera A.cerana diverged from Mellipona bicolor average 11.3 mln. Years ago. Forms and A.mellifera A.cerana, may have diverged from a common ancestor by an average 3.89 million. Years ago where A.cerana to 0.42 million. Years earlier separated from a common ancestor, so A.mellifera is age 3, 47 mln. years and A.cerana - 4,31 Mill. years.
We have shown a high degree of genetic relatedness of the Ural and Western European populations Ammellifera - the only representatives of the lineage M. 
  020. Ilyasov R.A., Poskryakov A.V., Komissar A.D., Nikolenko A.G. Phylogenetic Analisys Of Ukrainnian Bees. Materials of III International young scientists conference Biodiversity "Ecology. Adaptation. Evolution". Odessa. 2007. P. 117.  

Some hypotheses about an origin of the Ukrainian bees are known. The first approves, that they occur from Apis mellifera mellifera L. (Taranov, 1987), the second - from Apis mellifera сarnica Pollmann, 1879 (Gubin, 1977), the third - from hybridization of subspecies A.m.mellifera and Apis mellifera carpatica Foti et al., 1965 (Bilash, Krivtsov, 1991). F.Ruttner (1988) by morphometrical researches attributed the Ukrainian bees to Apis mellifera macedonica Ruttner, 1987, but did not include them in a map of distribution of A.m.macedonica, because he had not enough of samples. For define valid taxonomy position of the Ukrainian bees it is necessary to carry out phylogenetics researches by sequencing analysis.
In this work we has been determined nucleotide sequence of a fragment of gene ND2 of mitochondrial DNA (mtDNA) three samples of bees from Ukraine (A.D.Komissar's apiary near Kiev), three samples of bees from Russia (Republic Bashkortostan, Burzjansky region) from apiaries the Kapova-cave, the Koran-Elga, and from hollow tree nesting bees from national park "Shulgan-Tash". Analysed sequences of these bee samples have been deposit to GenBank (DQ181611-DQ181623, DQ361088-DQ361090). By comparison and calculation of average genetic distances between samples shown the close genetic relationship of bees from Ukraine from A.D.Komissar's apiary and bees of A.m.macedonica from Greece. Bees of subspecies A.m.mellifera from Russia, Apis mellifera ligustica Spinola, 1806 from Italy, A.m.carnica from Austria and Germany had mostly genetically distant from the Ukrainian bees.
Thus, sequencing analysis of a fragment of gene ND2 of mtDNA shown the Ukrainian bees has been attributed to subspecies A.m.macedonica. For the greater objectivity data we planned to expand number of bee samples.
До сих пор точно не известно о происхождении пчел Украины и их подвидовой принадлежности. Современная таксономия их относит к подвиду Apis mellifera sossimai Engel, 1999. Однако секвенционный анализ фрагмента гена ND2 мтДНК показал, что украинские пчелы могут относятся к подвиду A.m.macedonica.
  021. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Секвенционный анализ Apis mellifera mellifera L. на Урале. Материалы XIII съезда Русского энтомологического общества "Проблемы и перспективы общей энтомологии". Краснодар. 2007. С. 136-137.  

SEQUENCING ANALYSIS OF APIS MELLIFERA MELLIFERA L. IN URALS
R.A.Ilyasov, A.V.Poskryakov, A.G.Nikolenko
Внутривидовая систематика медоносной пчелы (Apis mellifera L.) до 60-х годов 20 века, то есть до начала использования молекулярных методов в изучении пчел, была основана на морфометрических методах. Современная систематика и филогенетика все чаще использует молекулярные методы, в частности, для медоносной пчелы применяются методы, основанные на ДНК-полиморфизме. Первоначальные исследования на основе рестрикционного анализа (RFLP) митохондриальной ДНК (мтДНК) (Smith, 1991), секвенционного анализа мтДНК (Cornuet et al., 1991; Garnery et.al., 1992), анализа полиморфизма микросателлитных локусов (Estoup et al., 1995; Viard et al., 1998) показали существование только трех эволюционных ветвей - А, М и С. Последующие исследования основанные на секвенционном анализе гена 2 субъединицы NADH-дегидрогеназы (ND2) мтДНК (Arias and Sheppard, 1996), RFLP анализе межгенного участка между генами 1 и 2 субъединицы цитохром оксидазы (COI-COII) мтДНК (Franck et al., 2000; Palmer et al., 2000) с использованием эндонуклеазы DraI, анализе полиморфизма микросателлитных локусов (Franck et al., 2000) показали существование также четвертой эволюционной ветви О. В дальнейшем P.Franck et al. (2001) на основе RFLP анализа межгенного участка COI-COII мтДНК с использованием рестриктазы DraI, показал существование пяти эволюционных ветвей А, М, С, О, Y.
На текущий момент подвиды подвержены интенсивной гибридизации, чего не избежали и локальные популяции A.m.mellifera эволюционной ветви М. На основе анализа частот комбинации PQQ межгенного локуса COI-COII мтДНК в популяциях пчел на Урале (Средний и Южный Урал) нами все же было показано существование четырех резерватов подвида A.m.mellifera (Ильясов с соавт., 2005).
Анализ нуклеотидной последовательности фрагмента гена ND2 со средней протяженностью 688 п.н. в 12 образцах четырех выделенных нами популяций показал, что между нуклеотидными последовательностями гена ND2 проанализированных образцов наблюдались транзиции в положениях 536, 621, 861, 1015, 1047, где транзиция Т>С в положении 536 в образцах DQ181614 и DQ181618 приводила к аминокислотной замене изолейцина Ile на треонин Thr. Трансверсий не было обнаружено. Нумерация нуклеотидной последовательности ведется относительно последовательности полной митохондриальной ДНК A.m.ligustica из генбанка NCBI (NC 001566).
Проанализированные нуклеотидные последовательности гена ND2 пчел уральской популяции были депонированны в генбанк (http://www.ncbi.nlm.nih.gov) под номерами DQ181611-DQ181622. Сравнение нуклеотидной последовательности гена ND2 уральских образцов с аналогичными последовательностями образцов A.m.mellifera европейских популяций (AY114495, U35758, U35759, U35760) показало их большое сходство, что показывает их единство происхождения и генетическое родство.
Таким образом, на Урале еще сохранилась часть уникальной европейской популяции A.m.mellifera, характеризующаяся значительным сходством по материнской линии мтДНК с европейскими популяциями A.m.mellifera. Для успешного сохранения генофонда A.m.mellifera и восстановления его первоначального ареала на Урале необходимо более детальное исследование пчел данного региона и определение границ распространения.
Intraspecific taxonomy of the honey bee (Apis mellifera L.) to the 60s of the 20th century, that is, before the start of the use of molecular methods in the study of bees, was based on morphometric techniques. Modern taxonomy and phylogenetics are increasingly using molecular methods, in particular, for the honeybee used methods based on DNA polymorphism. Initial studies on the basis of restriction enzyme analysis (RFLP) of the mitochondrial DNA (mtDNA) (Smith, 1991), analysis of mtDNA sekventsionnogo (Cornuet et al., 1991; Garnery et.al., 1992), microsatellite polymorphism loci (Estoup et al., 1995; Viard et al., 1998) revealed the existence of only three branches of evolution - A, M and C. Subsequent studies based on the analysis of gene sekventsionnom 2 subunit of NADH-dehydrogenase (ND2) mtDNA (Arias and Sheppard, 1996), RFLP analysis of the intergenic region between 1 and 2 genes, cytochrome oxidase subunit (COI-COII) mtDNA (Franck et al., 2000; Palmer et al., 2000) using endonuclease DraI, polymorphism analysis of microsatellite loci (Franck et al., 2000) showed the existence of the Fourth evolutionary branch O. Later P.Franck et al. (2001) based on RFLP analysis of the intergenic region of mtDNA COI-COII using the restriction enzyme DraI, revealed the existence of five evolutionary branches A, M, C, O, Y.
To date, the subspecies susceptible to intense hybridization, which did not escape the local population and evolutionary branch Ammellifera M. The analysis of combination frequencies PQQ intergenic locus COI-COII mtDNA in populations of bees in the Urals (Middle and South Ural), we still have shown the existence of four Reserves subspecies Ammellifera (Ilyasov et al., 2005).
Nucleotide sequence analysis of the gene fragment ND2 having an average length of 688 bp 12 samples of four populations isolated by us has shown that between the nucleotide sequences of the gene analyzed samples ND2 observed transitions at positions 536, 621, 861, 1015, 1047, where the transitions T> C at position 536 in samples DQ181614 and DQ181618 resulted in an amino acid substitution of isoleucine Ile threonine Thr. Transversions were detected. Numbering is carried out with respect to the nucleotide sequence of the complete mitochondrial DNA sequence from genebank Amligustica NCBI (NC 001566).
Analyzed the nucleotide sequence of the gene ND2 bees Ural population was deposited into the genebank (http://www.ncbi.nlm.nih.gov) under the numbers DQ181611-DQ181622. Comparison of the nucleotide sequence of the gene ND2 Ural models with similar sequences of samples Ammellifera European populations (AY114495, U35758, U35759, U35760) showed their great similarity that reveals their common origin and genetic relationship.
Thus, in the Urals, it has preserved a unique part of the European population Ammellifera, characterized by considerable similarity maternal mtDNA European populations Ammellifera. In order to successfully preserve the gene pool Ammellifera and restore its original habitat in the Urals need for more detailed study of the bees in the region and the definition of the boundaries of distribution.
  022. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Sequencing analysis of bees from Urals. Materials of International conference "XLIV naukowa konferencja pszczelarska". Pulawy. 2007. P. 29.  

Classification of a honey bees (Apis mellifera L.) has been based on morphometrical methods before beginning of use of molecular methods in bees studying. Modern systematics and phylogenetics often use molecular methods. In particular, the methods based on polymorphism of DNA are applied to a honey bee. Initial researches based on a restriction analysis (RFLP) of mitochondrial DNA (mtDNA) (Smith, 1991), sequencing analysis of mtDNA (Cornuet et al., 1991; Garnery et.al., 1992), analysis of polymorphism of microsatellite loci (Estoup et al., 1995; Viard et al., 1998) have shown existence only three evolutionary branches - A, M and C. Following researches based on sequencing analysis of 2 subunit of gene NADH- dehydrogenase (ND2) mtDNA (Arias and Sheppard, 1996), based on RFLP analysis intergenic site between 1 and 2 subunit of genes cytochrome-c-oxidase (COI-COII) of mtDNA by endonuclease DraI (Franck et al., 2000; Palmer et al., 2000), based on analysis of microsatellite loci polymorphisms (Franck et al., 2000) have shown existence fourth evolutionary branch O. Further P.Franck et al. (2001) by DraI endonuclease perform RFLP analysis of the intergenic locus COI-COII mtDNA, has shown existence of five evolutionary branches A, M, C, O, Y.
In recent time all subspecies and population of A.m.mellifera of an evolutionary branch M are subject to intensive hybridization. Analysis of frequencies of combination PQQ of intergenic locus COI-COII mtDNA in populations of bees in Urals (Middle and Southern Urals) has been shown existence of four reserves of subspecies A.m.mellifera (Ilyasov et al., 2005).
Analysis of nucleotide sequences of a fragment of gene ND2 with average size 688 b.p. in 12 samples of four populations has shown transitions in positions 536, 621, 861, 1015, 1047 between sequences of gene ND2 of the analysed samples. Transition Т>C in position 536 in samples DQ181614 and DQ181618 lead to replacement aminoacid isoleucine Ile by threonine Thr. Transversion was not revealed. Numbering of sequences is concerning sequence full mtDNA of  A.m.ligustica from GenBank NCBI (NC 001566).
Analysed sequences of gene ND2 of bees from Ural population were deposited to GenBank (http://www.ncbi.nlm.nih.gov) at numbers DQ181611-DQ181622. Sequence comparison of gene ND2 of the Urals bee samples with bees from European populations A.m.mellifera (AY114495, U35758, U35759, U35760) has shown their big similarity that shows their unity of an origin and genetic relationship.
Thus, part of unique European population A.m.mellifera which is subdivided into four subpopulations described by significant similarity with European populations of A.m.mellifera was still kept in Urals. For successful preservation gene pool of A.m.mellifera and restoration of its initial area in Urals is necessary more detailed research of bees of this region.
  023. Ильясов Р.А., Поскряков А.В., Колбина Л.М., Николенко А.Г. Сохранение Apis mellifera mellifera L. в Удмуртской республике. Пчеловодство. 2007. № 6. С. 13-14.

Сохранение Apis mellifera mellifera L. в Удмуртской республике (Saving Apis mellifera mellifera L. in the Udmurt Republic. Russian journal of beekeeping) Результаты показали, что на большинстве пасек преобладают семьи, происходящие от A. m. mellifera. Частота комбинации PQQ была очень высокой (>0,95) в некоторых хозяйствах Камбарского, Глазовского, Можгинского, Завьяловского районов. На пасеках Малопургинского района частота комбинации PQQ оказалась довольно низкой (<0,70). Такой же показатель был получен на пасеках с. Шаркан Шарканского района, с. Постол Завьяловского района и д. Вишур Малопургинского районов, что свидетельствует о завозе пчел южных подвидов (табл.). К сожалению, анализ проводили на крайне ограниченном числе образцов. Для получения более объективных данных планируется увеличить объем выборки в локальных популяциях, а также расширить число генетических маркеров для анализа генома в целом. Наибольший интерес для нас представляют северные районы Удмуртии, где благодаря жесткому естественному отбору (как, например, уникальная популяция A. m. mellifera в Красновишерском районе Пермского края) велика вероятность сохранения популяций A. m. mellifera. The results showed that most apiaries dominated family, originating from A. m. mellifera. Frequency combination PQQ was very high (> 0.95) in the number of farms Kambarka, Glazov, Mozhginskosecond, Zavyalovsky areas. Apiaries Mat lopurginskogo district frequency combination PQQ was quite low (<0.70). such the same figure was derived from apiaries p. Sharkan Sharkansky District, p. Postol Zavyalovsky district and village. Vishur Malopurginskogo areas, indicating that the importation bees southern subspecies (Table.). Unfortunately, the analysis was performed at an extremely a limited number of samples. for more objective data is planned increase the sample size in the local populations, as well as expand the number of Genetic markers for genome analysis in general. Of greatest interest to us represent the northern regions of Udmurtia, where, thanks to the hard natural selection (such as a unique population of A. m. mellifera in Krasnovishersky District Perm Krai) likely conservation of populations A. m. mellifera. Publication Name: Ilyasov R.A., Poskryakov A.V. Kolbina L.M., Nikolenko A.G. Saving Apis mellifera mellifera L. in the Udmurt Republic. Russian journal of beekeeping. 2007. V. 6. P. 13-14.
  024. Ильясов Р.А., Поскряков А.В., Колбина Л.М., Николенко А.Г. Сохранение Apis m.mellifera в Удмуртской республике. Материалы Российской региональной научно-практической конференции "Экологические и биологические основы разведения пчел и диких пчелиных как опылителей энтомофильных культур в условиях северо-восточного региона Российской Федерации". Ижевск. 2007. С 79-81.  

Для определения подвидовой принадлежности пчел был использован полиморфизм межгенного локуса COi-COil митохондриальной ДНК (мтДНК), комбинация PQQ которого характеризует происхождение пчел от А.т.mellifera по материнской линии (Ильясов и др., 2006). Всего было проанализировано 69 семей пчел с 11 пасек 6 районов Удмуртии (рис. 1).
Результаты показали, что на большинстве пасек преобладали семьи, имеющие происхождение от A.m.mellifera. Частота комбинации PQQ была очень высокой (>0,95) на некоторых пасеках Камбарского, Глазовского, Можгинского, Завьяловского, а в Мало-Пургинском районе частота комбинации PQQ оказалась довольно низкой (<0,70). На пасеках с. Шаркан Шарканского района, с. Постол Завьяловского района и д. Вишур Мало-Пургинского районов наблюдалась довольно низкая частота комбинации PQQ (<0,70), что свидетельствует о завозе пчел южных подвидов (табл. 1).
К сожалению, анализ проводился на очень ограниченном количестве образцов. Для получения более объективных данных планируется увеличить объем выборки из локальных популяций, а также расширить число генетических маркеров. Наибольший интерес для нас представляют северные районы Удмуртии, Пермского края, где имеются большие шансы на сохранение популяций A.m.mellifera, благодаря более жесткому естественному отбору в северных условиях. Так, например, сохранилась уникальная популяция А.т.mellifera в Красновишерском районе Пермского края.
To determine the subspecies of bees was used intergenic polymorphism loci COi-COil mitochondrial DNA (mtDNA), which is characterized by a combination of PQQ origin of bees from A.t.mellifera maternal (Ilyasov et al., 2006). There were analyzed 69 bee colonies from 11 apiaries 6 Udmurtia regions (Fig. 1).
The results showed that in most apiaries dominated family, originating from Ammellifera. Frequency combination PQQ was very high (> 0.95) in some apiaries Kambarka, Glazov, Mozhginsky, Zavyalovsky and in the area of ​​Little Purginskom frequency combinations PQQ was quite low (<0.70). On apiaries with. Sharkan Sharkansky district with. Postol Zavyalovsky district and village. Vishur Little Purginskogo areas, a rather low frequency combination PQQ (<0,70), indicating that the importation of bees southern subspecies (Table. 1).
Unfortunately, the analysis was carried out on a very limited number of samples. For more objective data is planned to increase the sample size of the local population, as well as expand the number of genetic markers. Of greatest interest to us are the northern regions of Udmurtia, Perm region, where there are great chances of keeping populations Ammellifera, thanks to the hard natural selection in northern conditions. For example, to preserve the unique population A.t.mellifera in Krasnovishersk district of the Perm region.
  025. Ильясов Р.А., Поскряков А.В., Колбина Л.М., Николенко А.Г. Сохранение Apis mellifera m. в Удмуртской республике. Сборник статей "Апидология и пчеловодство". Выпуск 2. Ижевск. 2007. С 10-12.

Пчеловодство — одно из древнейших занятий человека. Известно, что в России им занимались с XI века славяне, башкиры, мордвинцы, марийцы, удмурты, которые жили по берегам Вол и, Оки, Клязьмы (Суворин, Болсу- новский, 1990). Аборигенными пчелами для Поволжья были среднерусские пчелы, то есть пчелы подвида Apis melhfera mellifera L. Однако за последние 100 лет во многих регионах России произошла гибридизация подвидов пчел. Начиная с 20-х годов XX века в большом количестве стали завозить в Поволжье пчел из южных регионов. До 70-х годов гибридизация шла в основном за счет завоза в северные районы кавказских пчел A.m.caucasica, а позже - карпатских пчел (Черевко, 2005). По данным исследований морфометрических признаков медоносных пчел шести районов Удмуртской Республики только 12,3% пчел можно отнести к среднерусской породе. Однако авторы сами признают малую эффективность морфометрических методов в определении подвидовой принадлежности пчел в условиях интенсивной гибридизации (Колбина, Непейвода, 2005; 2006).
В 1994 году на основе данных многолетнего сравнительного изучения и производственного испытания подвидов пчел в различных зонах России коллегией Министерства сельского хозяйства и продовольствия был принят новый вариант районирования пород пчел в регионах РФ, согласно которому для природно-климатических условий Удмуртии был рекомендован подвид A.m.mellifera, или среднерусская порода пчел. Таким образом, восстановление популяции A.m.mellifera на данный момент стало основной задачей пчеловодства Удмуртии. Первый и основной шаг в восстановлении популяций A.m.mellifera в Удмуртской Республике - поиск сохранившихся популяций с использованием более эффективных методов идентификации подвидов по сравнению с морфометрическими. Известно, что молекулярно-генетические методы способны различать подвиды пчел в условиях интенсивной гибридизации, что и было нами использовано.
Для определения подвидовой принадлежности пчел был использован полиморфизм межгенного локуса COI-COII митохондриальной ДНК (мтДНК), комбинация PQQ которого характеризует происхождение пчел от A.m.mellifera по материнской линии (Ильясов и др., 2006). Всего было проанализировано 69 семей пчел с 11 пасек 6 районов Удмуртии.
Результаты показали, что на большинстве пасек преобладали семьи, имеющие происхождение от A.m.mellifera. Частота комбинации PQQ была очень высокой (>0,95) на некоторых пасеках Камбарского, Глазовского. Можгинского, Завьяловского. а в Мало-Пургинском районе частота комби- миии PQQ оказалась довольно низкой (<0,70). На пасеках с. Шаркан Шар- шмехого района, с. Постол Завьяловского района и д. Вишур МалоПургинского районов наблюдалась довольно низкая частота комбинации PQQ (<0,70), что свидетельствует о завозе пчел южных подвидов (табл. 1).
К сожалению, анализ проводился на очень ограниченном количестве образцов. Для получения более объективных данных планируется увеличить объем выборки из локальных популяций, а также расширить число генетических маркеров. Наибольший интерес для нас представляют северные районы Удмуртии, где имеются большие шансы на сохранение популяций A m.mellifera, благодаря более жесткому естественному отбору в северных условиях. Так, например, сохранилась уникальная популяция A.m.mellifcra в Красновишерском районе Пермского края.
Beekeeping - one of the oldest human activities. We know that in Russia, they were engaged in the XI century the Slavs, Bashkirs, Mordvintsev, Mari, Udmurts, who lived along the banks and Wall, Oka, Klyazma (Suvorin Bolsu--ray, 1990). Aboriginal bees to the Volga region were Central Russian bees, ie bee subspecies Apis melhfera mellifera L. However, over the last 100 years in many regions of Russia there was a hybridization of subspecies of bees. Since the 20-ies of XX century in large quantities were imported in the Volga region of bees from southern regions. Until the 70s hybridization was mainly due to the delivery to the northern areas of the Caucasian bees Amcaucasica, and later - the Carpathian bees (Cherevko, 2005). According to the research of morphometric characters of honeybees six districts of the Udmurt Republic only 12.3% of the bees can be attributed to the Central Russian breed. However, the authors themselves admit low efficiency morphometric methods in determining the subspecies of bees in the conditions of intensive hybridization (Kolbina, Nepeivoda, 2005; 2006).
In 1994, on the basis of long-term comparative study and testing of subspecies of bees in different regions of Russia Board of the Ministry of Agriculture adopted a new version of the zoning species of bees in the regions of the Russian Federation, according to which for the climatic conditions of Udmurtia was recommended subspecies Ammellifera, or Central Russian breed of bees. Thus, the recovery of populations Ammellifera at the moment has become the main task of beekeeping Udmurtia. The first and basic step in restoring populations Ammellifera in the Udmurt Republic - find the surviving population with the use of more effective methods of identifying subspecies compared with the morphometric. It is known that the molecular-genetic methods are able to distinguish subtypes of bees in the conditions of intensive hybridization, which was used by us.
To determine the subspecies of bees was used polymorphism of the intergenic locus COI-COII mitochondrial DNA (mtDNA), which is characterized by a combination of PQQ origin of bees from Ammellifera maternal (Ilyasov et al., 2006). There were analyzed 69 bee colonies from 11 apiaries 6 districts of Udmurtia.
The results showed that in most apiaries dominated family, originating from Ammellifera. Frequency combination PQQ was very high (> 0.95) in some apiaries Kambarka, Glazov. Mozhginsky, Zavyalovsky. and in the area of ​​Little Purginskom frequency combinations miii PQQ was quite low (<0.70). On apiaries with. Sharkan Shar shmehogo district with. Postol Zavyalovsky district and village. Vishur MaloPurginskogo areas, a rather low frequency combination PQQ (<0,70), indicating that the importation of bees southern subspecies (Table. 1).
Unfortunately, the analysis was carried out on a very limited number of samples. For more objective data is planned to increase the sample size of the local population, as well as expand the number of genetic markers. Of greatest interest to us are the northern regions of Udmurtia, which are more likely to preserve populations of A m.mellifera, thanks to the hard natural selection in northern conditions. For example, to preserve the unique population Ammellifcra in Krasnovishersk district of the Perm region. 
  026. Ильясов Р.А., Поскряков А.В., Николенко А.Г., Комиссар А.Д. Украинские пчелы Apis mellifera sossimai - отдельный подвид или северо-западно причерноморский экотип пчел Apis mellifera macedonica?. Сборник статей "Апидология и пчеловодство". Выпуск 2. Ижевск. 2007. С 12-20.

Известно, что украинская медоносная пчела подвида Apis mellifera sossimai Engel, 1999 (старое неверное название Apis mellifera acervorum Scorikov), аборигенна для большей части Украины и некоторых юго-западных регионов России. Также известно, что генотип этого подвида пчел является составляющим генофонда пчел дальневосточной популяции, имеющих, как известно, гибридное происхождение. К сожалению, еще не была определена граница распространения A.m.sossimai на Западе. В Румынии считают, что там обитает уникальный аборигенный подвид медоносной пчелы - Apis mellifera carpatica Foti et al., 1965, ареал которого - долины карпатских гор. Восточная же граница ареала A.m.carpatica до сих пор не определена.
Существует несколько гипотез о происхождении украинских пчел - от простого утверждения, что они являются южной ветвью Apis mellifera mellifera L. (Таранов, 1987) и заявления, что они являются видоизмененной популяцией Apis mellifera carnica Pollmann, 1879 (Губин, 1977) до более сложного - результат бессистемной гибридизации подвидов A.m.mellifera и A.m.carpatica и дальнейшего длительного естественного отбора в условиях степей Украины (Билаш, Кривцов, 1991).
F.Ruttner (1988) на основе морфометрических исследований показал, что пчелы северной Греции могут быть выделены в отдельный подвид Apis mellifera macedonica Ruttner, 1987. Кроме того F.Ruttner (1988) показал, что пчелы на территории Болгарии и Румунии также относятся к подвиду A.m.macedonica, хотя в каждой из этих стран считают, что у них свой аборигенный подвид пчелы, а не A.m.macedonica. Из Украины через НИИ пчеловодства России (г.Рыбное) F.Ruttner (1988) получил только две матки и определил, что их также можно отнести к A.m.macedonica. Конкретное место происхождения этих маток осталось неизвестным. Сами результаты F.Ruttner (1988), описанные только в его монографии 1988 года очень долго оставались неизвестными апидологам Украины и России. Поскольку у F.Ruttner (1988) не было достаточного количества материала с Украины, он не включил ее в карту распространения A.m.macedonica, но его данные можно рассматривать как нечетко сформированную гипотезу о принадлежности украинских пчел к подвиду A.m.macedonica.
Сопоставление  морфологических характеристик болгарских, румынских и украинских пчел позволило А.Д.Комиссару (2003) утверждать, что это может быть один подвид медоносной пчелы, всего лишь называемый по-разному в разных странах, поскольку при проведении исследований ученые из этих стран часто ограничивались только границами своей страны.
Впоследствии несколько десятков образцов украинских пчел было проанализировано с использованием дискриминантного компьютерного анализа 30 параметров жилкования крыльев в Чехии в Институте пчеловодства (Чермак, Комиссар, неопубликованные результаты). Первоначальной целью этих исследований было создание стандарта украинских пчел по жилкованию крыльев, который позволил бы быстро отличать их от пчел других подвидов и такой временный стандарт даже был создан. Однако оказалось, что большинство исследованных образцов украинских пчел по данному признаку можно было отнести к подвиду A.m.macedonica. Таким образом, идентификацию украинских пчел, как оказалось, можно проводить по существующему стандарту A.m.macedonica. Эти данные подтвердили гипотезу F.Ruttner (1988) о том, что украинские пчелы являются субпопуляцией единой популяции A.m.macedonica, распространенной на территории нескольких стран восточной Европы. Однако существующее мнение о том, что украинские пчелы - отдельный подвид пчел, очень устойчиво. Даже в международной номенклатуре украинские пчелы приняты за отдельный подвид A.m.sossimai Engel, 1999. Для уточнения действительного таксономического статуса украинских пчел необходимо провести дополнительные исследования с использованием молекулярно-генетических методов.
Мы поставили цель – показать, какой из подвидов европейских пчел наиболее генетически близок к украинским пчелам на основе сравнения нуклеотидных последовательностей фрагмента гена ND2 митохондриальной ДНК (мтДНК) украинских пчел A.m.sossimai, с A.m.macedonica из Греции, A.m.carnica из Германии и Австрии, Apis mellifera ligustica Spinola, 1806 из Италии, A.m.mellifera из республики Башкортостан.
При работе с украинскими пчелами существовала большая опасность того, что в качестве образцов украинских пчел могли попасть гибридные и тогда бы наши выводы могли быть неверными. Действительно, проведенный в Чехии компьютерный анализ жилкования крыльев пчел из племенных семей лучшего питомника Института пчеловодства Украины показал, что большая часть из них – это гибридные пчелы (Комиссар, 2006). Поэтому для анализа мы взяли пчел из личной пасеки А.Д.Комиссара, где содержались племенные чистые линии украинских пчел, отобранные на основании анализов по жилкованию крыльев в Чехии. Следует отметить, что на основании анализов по жилкованию крыльев были отбракованы около 50% семей, полученных с пасеки Л.Егошина в Сумской области.
В работе нами была определена нуклеотидная последовательность фрагмента гена ND2 мтДНК трех образцов пчел из Украины (пасека А.Д.Комиссара около г. Киева) (номера в международных генбанках EMBL, NCBI, DDBJ: DQ361088, DQ361089, DQ361090), трех образцов пчел из России (Республика Башкортостан, Бурзянский район) с пасеки Капова-Пещера (DQ181612), с пасеки Коран-Елга (DQ181613), и из бортей Государственного природного заповедника «Шульган-Таш» (DQ181611) (табл. 1).
Определение нуклеотидной последовательности фрагмента гена ND2 мтДНК проводили на автоматическом секвенаторе ABI Prism 310 Genetic Analyser (PE Applied Biosystems, USA) с использованием набора для флюоресцентного мечения DYEnamicTMET согласно протоколу фирмы производителя (Amersham Pharmacia Biotech DYEnamic ET Terminator Cycle Sequencing Kit).
В сравнении были использованы нуклеотидные последовательности фрагмента гена ND2 мтДНК рабочих особей пчел из Греции, Германии Австрии и Италии (всего 18 образцов пчел) (табл. 1). Образцы подвида A.m.mellifera - представители эволюционной ветви М - в данном сравнении были использованы в качестве аутгруппы для укоренения полученной филогенетической схемы. Представители подвидов A.m.ligustica и A.m.carnica были использованы в сравнении для того, чтобы выявить возможную гибридизацию украинских пчел с A.m.ligustica и A.m.carnica в связи с их большой популярностью среди пчеловодов Восточной и Западной Европы.
Известно, что фрагмент гена ND2 мтДНК вариабелен по нуклеотидному составу (Arias, Sheppard, 1996). Анализ нуклеотидной последовательности фрагмента гена ND2 мтДНК размером 574 п.н. показал однонуклеотидные замены в 10 позициях, из которых 9 были транзициями и 1 трансверсией (табл. 2). Отсчет нуклеотидов проводился относительно нуклеотидной последовательности полной митохондриальной ДНК подвида медоносной пчелы A.m.ligustica (NC 001566) просеквенированной R.H.Crozier и Y.C.Crozier (1993) размером 16343 п.н.
На основе сравнения нуклеотидных последовательностей фрагмента гена ND2 мтДНК пчел с использованием программы MEGA 3.1 (Kumar et al., 2004) и дальнейшего расчета средних генетических расстояний между образцами было показано тесное генетическое родство пчел из Украины с пасеки А.Д.Комиссара и пчел A.m.macedonica из Греции, где средние генетические расстояния между образцами A.m.macedonica и A.m.sossimai были равны 0,0000 (табл. 3).
Таким образом, наиболее генетически отдаленными от украинских пчел оказались пчелы A.m.mellifera из республики Башкортостан России (уникальной сохранившейся аборигенной популяции A.m.mellifera), что вполне логично, так как A.m.macedonica, A.m.carnica, A.m.ligustica – представители эволюционной ветви С (Ruttner, 1988), а A.m.mellifera – эволюционной ветви М.
На основе генетических дистанций с использованием программы MEGA 3.1 и метода кластеризации ближайшего соседа (Saitou and Nei, 1987) была построена филогенетическая схема (рис. 1), на которой можно наблюдать генетическое родство между подвидами пчел. Все образцы A.m.macedonica и A.m.sossimai объединились в одну группу, что говорит о тесном генетическом родстве украинских и греческих пчел. В другую группу объединились пчелы A.m.carnica Германии и Австрии, которые наиболее близки A.m.macedonica. Представители A.m.mellifera республики Башкортостан оказались наиболее отдаленными от A.m.macedonica и, соответственно, от A.m.sossimai.
Таким образом, нет никаких оснований говорить о том, что украинские пчелы – это южная ветвь среднерусских пчел A.m.mellifera или результат бессистемной гибридизации A.m.mellifera с A.m.carpatica. Но у нас есть все основания утверждать, что украинские пчелы A.m.sossimai являются субпопуляцией подвида A.m.macedonica.
Образцы пчел A.m.ligustica Италии разделились на две группы, одна из которых была очень близка к A.m.macedonica, а другая находилась на заметном отдалении. Согласно результатам исследований морфометрических характеристик A.m.ligustica Италии обладал большим сходством с A.m.carnica Австрии и Югославии (Ruttner, 1988). Мы полагаем, что, возможно, часть популяций A.m.ligustica Италии была гибридизована с A.m.mellifera Франции, что также подтверждалось в работе P.Franck et al. (2000) на основе изучения полиморфизма межгенного локуса COI-COII мтДНК.
Выводы:
1.    Исходя из сравнительного анализа нуклеотидных последовательностей фрагмента гена ND2 мтДНК можно утверждать, что исследованные образцы украинских пчел относятся к подвиду A.m.macedonica.
2.    Полученные результаты позволяют исключить предположения о том, что украинские пчелы являются южной ветвью среднерусских пчел A.m.mellifera или результатом ее бессистемной гибридизации с карпатскими пчелами A.m.carpatica.
3.    На основе оценки генетических расстояний можно утверждать, что краинские A.m.carnica и македонские A.m.macedonica пчелы по отношению друг к другу являются подвидами, а не экотипами одного подвида, что отвергает гипотезу В.Губина (1977) о том, что украинские пчелы могут быть одной из популяций A.m.carnica.
4.    Полученные данные являются еще одним подтверждением предположения F.Ruttner (1988) о возможной принадлежности украинских пчел к A.m.macedonica. Существует много оснований предполагать, что украинские пчелы A.m.sossimai Engel 1999 не отдельный подвид, а украинская популяция A.m.macedonica с возможным названием Apis mellifera macedonica var. ukrainica (предложение А.Д.Комиссара, 2005).
It is known that Ukrainian honeybee subspecies Apis mellifera sossimai Engel, 1999 (old Incorrect Apis mellifera acervorum Scorikov), indigenous to most of Ukraine and some south-western regions of Russia. It is also known that the genotype of this subspecies of bees is a component of the gene pool of the population of the Far Eastern bees, have been known to hybrid origin. Unfortunately, there has not been determined Amsossimai border of the West. In Romania, believe that there resides a unique subspecies of native honey bee - Apis mellifera carpatica Foti et al., 1965, the area of ​​which - the valley of the Carpathian Mountains. The eastern boundary of the range Amcarpatica has not yet been determined.
There are several hypotheses about the origin of Ukrainian bees - from the simple statement that they are the southern branch of the Apis mellifera mellifera L. (Taranov 1987) and the statements that they are modified population of Apis mellifera carnica Pollmann, 1879 (Gubin, 1977) to the more complex - the result of haphazard and hybridization subspecies Ammellifera Amcarpatica and further extended natural selection in terms of the steppes of Ukraine (Bilash, Krivtsov, 1991).
F.Ruttner (1988), based on morphometric studies have shown that bees northern Greece can be allocated to a separate subspecies of Apis mellifera macedonica Ruttner, 1987. In addition F.Ruttner (1988) showed that the bees on the territory of Bulgaria and Rumunii also belong to the subspecies Ammacedonica, although in each of these countries consider that they have their own subspecies of native bees, not Ammacedonica. From Ukraine through Russian Research Institute of Apiculture (g.Rybnoe) F.Ruttner (1988) I received only two of the uterus and determined that they can also be attributed to Ammacedonica. The specific place of origin of the queens remained unknown. The results themselves F.Ruttner (1988) described only in his monograph in 1988 for a long time remained unknown apidologam Ukraine and Russia. Since F.Ruttner (1988) did not have enough material from the Ukraine, he did not include it in the map of distribution Ammacedonica, but data can be regarded as a clearly formed the hypothesis of belonging to the Ukrainian bee subspecies Ammacedonica.
Comparison of the morphological characteristics of the Bulgarian, Romanian and Ukrainian bees allowed A.D.Komissaru (2003) argue that this may be one of the honey bee subspecies, just called differently in different countries, because the research scientists from these countries are often limited to only the borders of their country.
Subsequently, a few dozen specimens Ukrainian bees were analyzed using discriminant analysis computer 30 parameters venation wings in the Czech Republic at the Institute of beekeeping (Cermak, Commissioner, unpublished results). The initial aim of this research was to create a standard Ukrainian bees wing venation that would quickly distinguish them from other subspecies of bees, and even a temporary standard was created. However, it appeared that most of the samples Ukrainian bees on this basis can be attributed to the subspecies Ammacedonica. Thus, the identification of the Ukrainian bees, as it turns out, can be carried out on the existing standard Ammacedonica. These data support the hypothesis F.Ruttner (1988) that the Ukrainian bees are a subset of a single population Ammacedonica, spread across several countries in eastern Europe. However, the existing opinion that the Ukrainian bee - separate subspecies of bees, it is very stable. Even in the international nomenclature Ukrainian bee taken as a separate subspecies Amsossimai Engel, 1999. To clarify the actual taxonomic status of Ukrainian bees need to conduct additional studies using molecular genetic techniques.
We set a goal - to show which of the subspecies of European bees most genetically similar to Ukrainian bees by comparing the nucleotide sequences of the gene fragment ND2 mitochondrial DNA (mtDNA) Ukrainian bees Amsossimai, with Ammacedonica from Greece, Amcarnica from Germany and Austria, Apis mellifera ligustica Spinola, 1806 from Italy, Ammellifera of the Republic of Bashkortostan.
When working with the Ukrainian bees there is great danger that as samples Ukrainian bees could get hybrid and then it would be our conclusions might be incorrect. Indeed, in the Czech Republic carried out a computer analysis of the venation of the wings of bees from tribal families better nursery Apiculture Institute showed that most of them - a hybrid bee (Commissioner, 2006). Therefore, we have taken for analysis of individual bee apiary A.D.Komissara where tribal kept clean lines Ukrainian bees, selected on the basis of analyzes of wing venation in the Czech Republic. It should be noted that based on the analysis of wing venation were culled about 50% of families received from the apiary L.Egoshina in Sumy region.
In this paper we determined the nucleotide sequence of a gene fragment ND2 mtDNA three samples of bees from Ukraine (apiary A.D.Komissara around Kiev) (numbers in international genebanks EMBL, NCBI, DDBJ: DQ361088, DQ361089, DQ361090), three samples of bees Russia (Bashkortostan, Burzyan district) from the apiary Kapova-Cave (DQ181612), from the apiary Quran-Elga (DQ181613), and of the board of the State Natural Reserve "Shulgan-Tash» (DQ181611) (Table. 1).
Determination of the nucleotide sequence of the gene fragment ND2 mtDNA performed on an automatic sequencer ABI Prism 310 Genetic Analyser (PE Applied Biosystems, USA) using a kit for the fluorescent labeling DYEnamicTMET according to the protocol of the manufacturer (Amersham Pharmacia Biotech DYEnamic ET Terminator Cycle Sequencing Kit).
Compared were used nucleotide sequences of mtDNA gene fragment ND2 bees working individuals from Greece, Germany, Austria and Italy (all 18 samples of bees) (Table. 1). Samples subspecies Ammellifera - M representatives evolutionary branch - in this comparison were used as outgroup to root the resulting phylogenetic schemes. Representatives subspecies Amligustica and Amcarnica were used for comparison in order to identify a possible hybridization Ukrainian bees Amligustica Amcarnica and due to their great popularity among beekeepers in Eastern and Western Europe.
It is known that a gene fragment ND2 mtDNA is variable in nucleotide composition (Arias, Sheppard, 1996). Nucleotide sequence analysis of mtDNA ND2 gene fragment size 574 bp He showed single nucleotide substitutions in positions 10, 9 of which were transitions and transversions 1 (tab. 2). Counting was carried out with respect to nucleotides of the nucleotide sequence of full mitochondrial DNA subspecies of honeybee Amligustica (NC 001566) and sequenced RHCrozier YCCrozier (1993) the size of 16343 bp
Based on a comparison of the nucleotide sequences of mtDNA gene fragment ND2 bees using the program MEGA 3.1 (Kumar et al., 2004) and further calculation of the average genetic distance between samples was shown a close genetic relationship of bees from Ukraine to the apiary and bee A.D.Komissara Ammacedonica from Greece, where the average genetic distances between samples and Ammacedonica Amsossimai were equal to 0.0000 (Table. 3).
Thus, the most genetically distant from the Ukrainian bee bee appeared Ammellifera of Bashkortostan Republic of Russia (unique surviving indigenous populations Ammellifera), which is quite logical, since Ammacedonica, Amcarnica, Amligustica - representatives of evolutionary branches from (Ruttner, 1988) and Ammellifera - evolutionary branch M.
On the basis of genetic distances using the program MEGA 3.1 and the nearest neighbor clustering method (Saitou and Nei, 1987) was constructed phylogenetic diagram (Fig. 1), which can be observed genetic relatedness between subspecies of bees. All samples Ammacedonica and Amsossimai merged into one group, which suggests a close genetic relationship Ukrainian and Greek bees. In another group of bees Amcarnica united Germany and Austria, which are closest Ammacedonica. Representatives of the Republic of Bashkortostan Ammellifera were the most distant from Ammacedonica and, accordingly, from Amsossimai.
Thus, there is no reason to say that the Ukrainian bee - is the southern branch of the Central Russian bees Ammellifera or haphazard result of hybridization with Ammellifera Amcarpatica. But we have every reason to believe that Ukrainian are a subset of bees Amsossimai subspecies Ammacedonica.
Samples of bees Amligustica Italy were divided into two groups, one of which was very close to Ammacedonica, and the other was on a marked distance. According to the research of morphometric characteristics Amligustica Italy have much in common with Amcarnica Austria and Yugoslavia (Ruttner, 1988). We believe that, perhaps, part of the population Amligustica Italy was hybridized with Ammellifera France, which is also confirmed in the P.Franck et al. (2000), based on the study of polymorphism of the intergenic locus COI-COII mtDNA.
Findings:
1. On the basis of a comparative analysis of the nucleotide sequences of mtDNA gene fragment ND2 can be argued that the samples studied Ukrainian bee subspecies are Ammacedonica.
2. The results allow to exclude the assumption that Ukrainian bees are the southern branch of the Central Russian bees Ammellifera or results of unsystematic hybridization with Carpathian bees Amcarpatica.
3. On the basis of the assessment of genetic distances can be argued that the Krajina Amcarnica and Macedonian Ammacedonica bee in relation to each other is a subspecies, not ecotypes of subspecies, which rejects the hypothesis V.Gubina (1977) that the Ukrainian bees can be one of the populations Amcarnica.
4. The findings are further confirmation of the assumptions F.Ruttner (1988) about a possible affiliation to the Ukrainian bees Ammacedonica. There are many reasons to believe that the Ukrainian bee Amsossimai Engel 1999 not a separate subspecies, and the Ukrainian population Ammacedonica with possible name Apis mellifera macedonica var. ukrainica (proposal A.D.Komissara, 2005).
  027. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Пчелы среднерусской расы Apis mellifera mellifera L. на Урале. Вестник Оренбургского государственного университета. № 75. Оренбург. 2007. С. 146-148.  

Пчелы среднерусской расы Apis mellifera mellifera L. на Урале (Honey bees of Apis mellifera mellifera L. in the Central Urals) Приводятся данные о популяции пчелы среднерусской расы Apis mellifera mellifera L. на Урале. В диком виде этот подвид пчелы сохранился только в бортях в горно-лесной зоне Южного Урала. В Республике Башкортостан создан заповедник по охране бортевых пчел. Выявлены основные места обитания пчел среднерусской расы на Урале. В Институте биохимии и генетики лабораторией биохимии адаптивности насекомых под руководством профессора А.Г. Николенко разработан эффективный метод генетической идентификации пчел подвида A.m.mellifera на Урале на основе изучения полиморфизма генов ядерной и митохондриальной ДНК, а также биохимического анализа продуктов экспрессии генов, ответственных за его иммунитет и устойчивость. The data on the population of bees Central Russian race Apis mellifera mellifera L. in the Urals. In the wild, this subspecies of bees preserved only in the board in the mountain forest zone of the Southern Urals. In the Republic of Bashkortostan reserve has been established for the protection of wild-hive of bees. The basic habitat of Central bees race in the Urals. At the Institute of Biochemistry and Genetics Laboratory Biochemistry adaptability insects under the direction of Professor AG below Kolenko developed an effective method of genetic identification bee subspecies Ammellifera the Urals-based study polymorphism of nuclear and mitochondrial DNA and biochemical Analysis of expression products of genes responsible the immune system and its stability. Publication Name: Ilyasov R.A., Poskryakov A.V. Nikolenko A.G. Honey bees of Apis mellifera mellifera L. in the Central Urals. Bulletin of the Orenburg State University. V. 75. 2007, P. 146-148.
  028.Поскряков А.В., Ильясов Р.А. Бурзянская популяция темной лесной пчелы Apis mellifera mellifera L. и перспективы ее сохранения. Материалы международной конференции "Пчеловодство - XXI века". Москва. 2008. С.300-301.  

Подвид Apis mellifera mellifera L. (темная лесная пчела – в Европе, или среднерусская - в России)  занимал обширную территорию от Британских островов до Урала, вдоль северной границы естественного видового ареала. Эволюция его проходила в суровых условиях, и он приобрел свойства, обеспечивающие его преимущество перед другими подвидами пчел. К сожалению, в течение 20 века ареал сильно сократился в результате интенсивной гибридизации, но предполагалось, что локальные популяции существуют, однако их соответствие чистопородности было под вопросом.
Считается, что в настоящее время  в Западной Европе практически невозможно найти негибридизованные семьи A.m.mellifera. В нашей стране A.m.mellifera также была подвержена интенсивной гибридизации в результате завоза пчел из южных регионов страны. Однако предполагалось, что в отдельных местах еще могли сохраниться популяции A.m.mellifera. Самая известная из них – бурзянская популяция бортевых пчел на территории Республики Башкортостан.
Еще в работах Г.А.Кожевникова (1929, 1931) подчеркивалось, что эта популяция исключительно чистая за счет более чем 1000-летней изоляции.
Условия существования пчел в бортях, их роль в экосистемах, предпочитаемость жилищ, методы содержания бортевых пчелиных семей и снижения ущерба от болезней, хищников и вредителей изучены пока недостаточно. Принципиальным вопросом является определение численности семей в естественных дуплах, для учета которых нет общепринятых методов. С одной стороны, ведущие специалисты отмечают критическое состояние генофонда башкирской пчелы: если не будут приняты кардинальные меры, мы безвозвратно потеряем ценных местных пчел даже в тех районах, где они еще сохранились. В Башкирии резко снижается продуктивность и отмечается большая гибель, как следствие сплошной гибридизации (Шакиров, 1966, 1987, 1988). В последние годы появилась опасность исчезновения даже чистопородных бортевых пчел заповедника «Шульган-Таш» под влиянием завезенных в Башкирию других рас (Шафиков, 1978). С другой стороны Агентство по пчеловодству Республики Башкортостан сообщает о стабилизации и улучшении ситуации (Шагимухаметов, 1999). Таким образом, реальных фактов, которые бы позволили сделать выводы, пока не так много.
Кроме того, бортевые пчелы не могут существовать абсолютно изолированно. Так как сама популяция бортевых пчел небольшая, она нуждается в постоянном пополнении за счет пасечных пчел. Поэтому окружающие пасеки играют большую роль. Между бортевыми пчелами и пасечными идет постоянный обмен, и эти процессы помогают сохранить популяцию. Доказательством этого является опыт Южноуральского заповедника (Республика Башкортостан), где с исчезновением деревень полностью исчезли и бортевые пчелы, хотя сами борти сохранились.
Правительство РБ, администрации Бурзянского района и заповедника Шульган-Таш уделяют большое внимание сохранению бурзянской популяции. Большую помощь оказывают также международные организации, в частности Всемирный фонд охраны дикой природы (WWF). На территории заповедника ведется племенная работа, администрацией района издан указ о запрете на ввоз пчел других подвидов, в 1997 году создан  заказник Алтын солок. В настоящее время намечается расширение территории заповедника Шульган-Таш, что поможет сохранить биологическое и ландшафтное разнообразие широколиственных лесов, а, следовательно, и сохранить среду обитания бурзянских пчел. Расширение планируется на 36 тыс. га в западном направлении за счет неосвоенной территории на стыке Мелеузовского, Ишимбайского и Бурзянского районов в междуречье Нугуша и его правого притока Уряка, где нет населенных пунктов, животноводческих объектов и лесозаготовок. Здесь сохранились экологически ценные коренные старовозрастные леса, которых, к счастью, еще не коснулась интенсивная хозяйственная деятельность человека. Если этот проект будет одобрен, то площадь охраняемых мест обитания бурзянской пчелы вместе с Национальными парками "Башкирия" и  Алтын Солок увеличится до 230 тыс. га.
Кроме того, большое значение для сохранения популяции имеет корректная идентификация подвида. Нами ранее было показано, что в условиях интенсивной гибридизации широко используемый морфометрический метод идентификации подвидов пчелы не работает. Для решения этой проблемы мы разработали комплекс молекулярно-генетических методов.
Тем не менее, для гарантированного сохранения генофонда бурзянской популяции необходимо охватить не только особо охраняемые территории, а всю территорию Бурзянского района, потому что до сих пор  исследования данной популяции проводились точечно и ограничивались территорией заповедника Шульган-Таш. Генетические процессы внутри популяции и степень гибридизации исследованы по узкому спектру молекулярно-генетических методов. Кроме того, важно выявить границы ареала данной популяции для разработки общей стратегии  сохранения бурзянской пчелы.
The subspecies Apis mellifera mellifera L. (dark forest bee - in Europe, or the Mid - in Russia) occupied a vast territory from the British Isles to the Urals, along the northern border of the natural habitat of the species. Evolution it was held in harsh conditions, and it has acquired properties that provide it an edge over other subspecies of bees. Unfortunately, during the 20th century area of ​​greatly reduced as a result of intensive hybridization, but it was assumed that the local population there, but their correspondence was a pure breed in question.
It is estimated that currently in Western Europe is almost impossible to find a non-hybridized family Ammellifera. In our country Ammellifera was also subject to intense hybridization resulting in the importation of bees from the southern regions of the country. However, it was assumed that in some places could still keep the population Ammellifera. The most famous of them - Burzyan population of wild-hive bee on the territory of the Republic of Bashkortostan.
Still in the works G.A.Kozhevnikova (1929, 1931) emphasized that this population extremely clean through more than 1,000-year isolation.
Conditions for the existence of bees in the board, their role in the ecosystem, preferred by dwellings, methods of detention wild-hive bee colonies and reduce damage from disease, predators and pests studied long enough. The fundamental question is to determine the number of families in natural cavities, for which there is no generally accepted accounting practices. On the one hand, leading experts say the critical state of the Bashkir bee gene pool, if not taken drastic measures, we will irrevocably lose valuable local bees, even in areas where they still exist. In Bashkiria drastically reduced productivity, and there is great destruction, as a result of continuous hybridization (Shakirov, 1966, 1987, 1988). In recent years, he appeared in danger of extinction, even purebred wild-hive bee reserve "Shulgan-Tash" under the influence of imported Bashkiria other races (Shafiq 1978). On the other hand the Agency on beekeeping RB reports the stabilization and improvement of the situation (Shagimuhametov, 1999). Thus, the real facts, which would allow to draw conclusions until not so much.
In addition, wild-hive bees can not completely exist in isolation. Since the very small population of wild-hive of bees, it needs constant replenishment due apiary bees. So the surrounding apiaries play a big role. In the wild-hive bees and beekeeping is a constant exchange, and these processes help to keep the population. Proof of this is the experience of South Ural Reserve (Republic of Bashkortostan) where the disappearance of the villages have completely disappeared and wild-hive bee, though they remained aboard.
The Government of the Republic of Belarus, and the district administration Burzyansky Reserve Shulgan-Tash pay great attention to the preservation Burzyan population. Most care is provided by international organizations such as the World Wildlife Fund (WWF). Within the reserve is being breeding work, the district administration issued a decree banning the importation of bees other subspecies in 1997 created reserve Altyn Solok. Currently planned expansion of the reserve Shulgan-Tash, which will help keep the biological and landscape diversity of deciduous forests, and, consequently, save the environment Burzyan bees. The expansion is planned for 36 th. Hectares to the west by undeveloped territory at the junction Meleuzovsky, Ishimbaisky Burzyansky areas and in the area between Nugush and its right tributary Uryaka where there are no settlements, livestock and logging facilities. Here are preserved ecologically valuable old-growth indigenous forest, which, fortunately, has not yet touched the intense human activities. If this project is approved, the area of ​​protected habitat Burzyan bee along with the national park "Bashkiria" Altyn Solok and will increase to 230 thousand. Ha.
In addition, of great importance to maintain the population has the correct identification of the subspecies. We have previously shown that under conditions of intense hybridization morphometric widely used method for identifying subtypes bees work. To solve this problem, we developed a set of molecular genetic methods.
However, to guarantee the preservation of the gene pool of a population Burzyan need to cover not only the protected areas, and the entire territory of Burzyansky area, because until now carried out studies of this population point and limited to the territory of the reserve Shulgan-Tash. Genetic processes in the population studied and the degree of hybridization on a narrow range of molecular genetic methods. In addition, it is important to identify the boundaries of the area of ​​a given population to develop a common strategy of preservation Burzyan bees.
  029. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Бурзянский экотип бортевой пчелы среднерусской расы Apis mellifera mellifera L. Материалы международной конференции "Биоразнообразие, проблемы экологии горного алтая и сопредельных регионов: настоящее, прошлое, будущее". Горно-Алтайск. 2008. С. 94-96.  

Одной из наиболее интересных для человека групп насекомых являются пчелы - свыше 16000 современных видов [1], но только вид Apis mellifera L. стал широко использоваться человеком в сельскохозяйственном разведении во всем мире.
Обширный естественный ареал медоносной пчелы охватывает всю Африку, Европу и Ближний Восток. Следствием этого явилась значительная внутривидовая дифференциация [2], на данный момент общепризнано существование 25 подвидов. На территории Европы известно существование 9 подвидов A.mellifera, 8 из которых обитает в Южной и Центральной Европе. Только 1 подвид Apis mellifera mellifera L. - темная европейская, темная лесная, она же среднерусская пчела - освоил лесостепную и лесную зоны Северной Европы, что делает его очень ценным для пчеловодства в северных странах. Ещё двести лет назад этот подвид занимал в Евразии огромную территорию вдоль северной границы естественного ареала вида. Эволюция A.m.mellifera протекала в суровых климатических условиях, в результате чего подвид стал отличаться исключительно высокой зимостойкостью, приспособленностью к использованию короткого бурного медосбора с липы, устойчивостью к нозематозу, варроатозу, аскосферозу и падевому токсикозу.
К сожалению, в результате непрерывного интенсивного импорта пчел с юга в северные регионы произошла массовая гибридизация пчёл. В Германии массивный импорт A.m.carnica в 1840-х годах привел почти к полной замене местных пчел A.m.mellifera [3]. В скандинавских странах и на Британских островах на большей части территории также вместо аборигенных пчел A.m.mellifera разводят A.m.ligustica и A.m.carnica [4, 5, 6].
Такая же ситуация сложилась и в России. Массовый завоз южных подвидов пчел в северные регионы был организован в период породного районирования пчел. В разработке плана породного районирования пчел в 1964-1975 гг. под руководством Научно-исследовательского института пчеловодства принимали участие научно-исследовательские и опытные учреждения, республиканские и областные конторы пчеловодства. В результате массового завоза пчел из южных районов в лесную и лесостепную зоны России, прежний ареал пчелы среднерусской расы оказался заселен в основном пчёлами гибридного происхождения.
Пчела среднерусской расы A.m.mellifera в России представлена несколькими сохранившимися локальными популяциями. Одной из них является бурзянская популяция бортевых пчел, сохранившаяся в горно-лесной зоне Республики Башкортостан. В работах Г.А.Кожевникова (1929, 1931) подчеркивалось, что эта популяция пчел исключительно чистая за счет более чем 1000-летней изоляции. Интерес к среднерусской пчеле, в особенности к её бурзянским и верхнекамским экотипам, в последние годы усиливается, значительно возрос спрос на пчел и маток этого подвида. Правительство РБ, администрации Бурзянского района и заповедника Шульган-Таш уделяют большое внимание сохранению бурзянской популяции пчел. Большую помощь оказывают также международные организации, в частности Всемирный фонд охраны дикой природы (WWF).
На территории заповедника ведется племенная работа, администрацией района издан указ о запрете на ввоз пчел других подвидов, в 1997 году создан заказник Алтын солок. В настоящее время намечается расширение территории заповедника Шульган-Таш, что поможет сохранить биологическое и ландшафтное разнообразие широколиственных лесов, а следовательно, и сохранить среду обитания бурзянских пчел. Расширение планируется на 36 тыс. га в западном направлении за счет неосвоенной территории на стыке Мелеузовского, Ишимбайского и Бурзянского районов в междуречье Нугуша и его правого притока Уряка, где нет населенных пунктов, животноводческих объектов и лесозаготовок. Здесь сохранились экологически ценные коренные старовозрастные леса, которых, к счастью, еще не коснулась интенсивная хозяйственная деятельность человека. Если этот проект будет одобрен, то площадь охраняемых мест обитания бурзянской пчелы вместе с Национальным парком Башкирия и заказником Алтын Солок увеличится до 230 тыс. га.
Условия существования пчел в бортях, их роль в экосистемах, предпочитаемость жилищ, методы содержания бортевых пчелиных семей и снижения ущерба от болезней, хищников и вредителей изучены пока недостаточно. Принципиальным вопросом является определение численности семей в естественных дуплах, для учета которых нет общепринятых методов. С одной стороны, ведущие специалисты отмечают критическое состояние генофонда башкирской пчелы: если не будут приняты кардинальные меры, мы безвозвратно потеряем ценных местных пчел даже в тех районах, где они еще сохранились. В Башкирии резко снижается продуктивность и отмечается большая гибель, как следствие сплошной гибридизации [7]. В последние годы появилась опасность исчезновения даже чистопородных бортевых пчел заповедника «Шульган-Таш» под влиянием завезенных в Башкирию других рас [8]. С другой стороны, Агентство по пчеловодству Республики Башкортостан сообщает о стабилизации и улучшении ситуации [9]. Таким образом, реальных фактов, которые бы позволили сделать выводы, пока не так много.
Известно, что популяции бортевых пчел не могут существовать абсолютно изолированно от пасечных популяций. Популяция бортевых пчел немногочисленна и нуждается в постоянном пополнении семьями с пасек. Поэтому окружающие пасеки играют значительную роль в обновлении генофонда. Между бортевыми пчелами и пасечными идет постоянный обмен, и эти процессы помогают сохранить популяцию. Доказательством этого является ситуация в Южноуральском заповеднике Республики Башкортостан, где с исчезновением деревень полностью исчезли бортевые пчелы и борти остались пустыми.
Большое значение для сохранения популяции пчел имеет корректная идентификация подвидовой принадлежности. Нами ранее было показано, что в условиях интенсивной гибридизации широко используемый морфометрический метод идентификации подвидов пчелы не работает. Для решения этой проблемы сотрудники лаборатории биохимии адаптивности насекомых в институте биохимии и генетики УНЦ РАН разработали комплекс молекулярно-генетических методов.
Для гарантированного сохранения генофонда бурзянской популяции необходимо исследовать пчел не только особо охраняемых территорий и Бурзянского района, но и прилегающих районов, потому что до сих пор исследования данной популяции проводились точечно и ограничивались территорией заповедника Шульган-Таш. Генетические процессы внутри популяции и степень гибридизации исследованы по узкому спектру молекулярно-генетических методов. Кроме того, важно выявить границы ареала данной популяции для разработки общей стратегии сохранения бурзянской пчелы.
One of the most interesting groups of insects are human bees - more than 16,000 modern species [1], but just kind of Apis mellifera L. was widely used by man in the agricultural cultivation worldwide.
Extensive natural range honeybee covers the whole of Africa, Europe and the Middle East. The result was significant intraspecific differentiation [2], at the moment it is generally accepted the existence of 25 subtypes. In Europe it is known the existence of 9 subspecies A.mellifera, 8 of which lives in South and Central Europe. Only 1 subspecies Apis mellifera mellifera L. - European dark, dark forest, she Central Russian bee - has mastered steppe and forest zones of Northern Europe, which makes it very valuable for beekeeping in the Nordic countries. More hundred years ago, this subspecies is served in the vast territory of Eurasia along the northern border of the natural range of the species. Evolution Ammellifera proceeded in severe climatic conditions, resulting in a different subspecies became exceptionally high winter hardiness, adaptability to the use of rapid short with linden honey yield, resistance to nosema, Varroa, askosferozu and honeydew toxicosis.
Unfortunately, as a result of continuous heavy imports of bees from the south to the northern regions there was a mass of bees hybridization. In Germany, a massive import Amcarnica in the 1840s has led to almost complete replacement of native bees Ammellifera [3]. In the Nordic countries and the British Isles in most of the well instead of native bees bred Ammellifera Amligustica and Amcarnica [4, 5, 6].
A similar situation exists in Russia. The massive importation of bees in the southern subspecies of the northern regions was organized in rock during the zoning bees. In the development plan zoning rock bees in 1964-1975 gg. under the supervision of the Research Institute of apiculture attended the scientific research and experimental institutions, national and regional offices of beekeeping. As a result, the mass importation of bees from southern areas in the forest and steppe zones of Russia, the former area of ​​the Central Russian bee races were inhabited mostly by bees hybrid origin.
Bee race of Central Ammellifera in Russia is represented by several local populations preserved. One of them is the population of wild-hive bee Burzyan preserved in the mountain forest zone of the Republic of Bashkortostan. In the works G.A.Kozhevnikova (1929, 1931) emphasized that this population of bees exceptionally clean through more than 1,000-year isolation. Interest in the Central Russian bees, especially to its Burzyan and Verkhnekamsk ecotypes in recent years strengthened significantly increased the demand for bees and queens of this subspecies. The Government of the Republic of Belarus, and the district administration Burzyansky Reserve Shulgan-Tash pay great attention to the preservation Burzyan bee population. Most care is provided by international organizations such as the World Wildlife Fund (WWF).
Within the reserve is being breeding work, the district administration issued a decree banning the importation of bees other subspecies in 1997 created reserve Altyn Solok. Currently planned expansion of the reserve Shulgan-Tash, which will help keep the biological and landscape diversity of deciduous forests, and hence to maintain the habitat Burzyan bees. The expansion is planned for 36 th. Hectares to the west by undeveloped territory at the junction Meleuzovsky, Ishimbaisky Burzyansky areas and in the area between Nugush and its right tributary Uryaka where there are no settlements, livestock and logging facilities. Here are preserved ecologically valuable old-growth indigenous forest, which, fortunately, has not yet touched the intense human activities. If this project is approved, the area of ​​protected habitat Burzyan bee with Bashkiria National Park and Reserve Altyn Solok increase to 230 thousand. Ha.
Conditions for the existence of bees in the board, their role in the ecosystem, preferred by dwellings, methods of detention wild-hive bee colonies and reduce damage from disease, predators and pests studied long enough. The fundamental question is to determine the number of families in natural cavities, for which there is no generally accepted accounting practices. On the one hand, leading experts say the critical state of the Bashkir bee gene pool, if not taken drastic measures, we will irrevocably lose valuable local bees, even in areas where they still exist. In Bashkiria drastically reduced productivity, and there is great destruction, as a result of continuous hybridization [7]. In recent years, he appeared in danger of extinction, even purebred wild-hive bee reserve "Shulgan-Tash" under the influence of imported Bashkiria other races. [8] On the other hand, the Agency of the Republic of Bashkortostan on beekeeping reports the stabilization and improvement of the situation. [9] Thus, the real facts, which would allow to draw conclusions until not so much.
It is known that the population of wild-hive bee can not exist in isolation from the apiary absolutely populations. Wild-hive bee population is sparse and needs constant replenishment of families with apiaries. So the surrounding apiaries play a significant role in the renewal of the gene pool. In the wild-hive bees and beekeeping is a constant exchange, and these processes help to keep the population. Proof of this is the situation in the Republic of Bashkortostan Yuzhnouralskaya Reserve, where the disappearance of villages completely disappeared wild-hive bee and the board remained empty.
Of great importance to maintain the population of bees is the correct identification of the subspecies. We have previously shown that under conditions of intense hybridization morphometric widely used method for identifying subtypes bees work. To solve this problem, the laboratory staff Biochemistry adaptability of insects at the Institute of Biochemistry and Genetics, Ufa Science have developed a set of molecular genetic techniques.
To ensure preservation of the gene pool of a population Burzyan necessary to investigate the bees not only protected areas and Burzyansky area, but the surrounding areas, because until now the study of this population were conducted spot and limited to the territory of the reserve Shulgan-Tash. Genetic processes in the population studied and the degree of hybridization on a narrow range of molecular genetic methods. In addition, it is important to identify the boundaries of the area of ​​a given population to develop a common strategy of preservation Burzyan bees.
  030. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Динамика изменения частот генов антибактериального пептида в популяции пчел на Урале. Материалы IV международной конференции "Биоразнообразие и биоресурсы Урала и сопредельных территорий". Оренбург. 2008. С. 134-136.  

Болезнетворные бактерии пчел широко распространены в почве, воде, воздухе и пище. В большинстве случаев бактерии попадают в полость тела пчелы через поглощаемый корм. Бактерии могут инфицировать пчел и через дыхальца или даже через раны, наносимые внешними паразитами – клещами Varroa jacobsoni [1]. Любое ранение кутикулы или пищеварительного тракта является входным путем для бактерий.
Личинки медоносных пчел могут быть поражены американским гнильцом Paenibacillus larvae larvae, европейским гнильцом Mellissococcus pluton, Bacillus pulvifaciens, а взрослые пчелы - Pseudomonas aeruginosa, Hafnia alvei, Enterococcus faecalis. Сапрофитные и патогенные бактерии растений могут также случайно индуцировать болезни пчел при попадании в полость тела.
Как известно, пчелы продуцируют антибактериальные пептиды для защиты от микроорганизмов. На данный момент у пчел известны антибактериальные пептиды - абецин, дефензин и гименоптецин, которые, по Б.В.Зюману (1992), являются необходимыми компонентами групповой и индивидуальной системы иммунитета пчелиной семьи. C.S.McCleskey, R.M.Melampy (1938) и H.Yamauchi (2001) продемонстрировали антибактериальные свойства маточного молочка пчел, секретируемого фарингеальными железами, которое активно против бактерий и грибков. K.Casteels-Johnson с соавт. (1994) изучали в гемолимфе у пчел, инфицированных Escherichia coli, четыре различных типа антимикробных каталитических пептидов – апидацин, гименоптецин, абецин и дефензин.
Антибактериальный пептид дефензин объединяет большое семейство цистеин-богатых каталитических антимикробных пептидов, воздействующих на разнообразные микроорганизмы, составляющих основную защитную систему большинства организмов. Дефензины пчел - пептиды длиной 36-51 аминокислот, обладающие сходством последовательности, основная структура которых состоит из концевых аминокислотных повторов, альфа-спирали и двух антипараллельных цепочек, стабилизированных 3-дисульфидными мостиками [2]. Дефензин обычно продуцируется последним из всех, но его активность продолжается свыше двух недель после инфекции [3]. Дефензин гемолимфы и его предшественник про-пептид были охарактеризованы по кДНК, выделенных из брюшной полости инфицированных пчел [4].
Другой дефензин пчел, названный роялизином, был выделен из маточного молочка пчел и был охарактеризован S.Fujiwara с соавт. (1990) на уровне пептидов. Оба дефензина пчел содержали 51 аминокислоту. Они отличались по одной аминокислоте и по группе, состоящей из двух аминокислот при сравнении последовательностей, представленных в международном GeneBank (http://www.ncbi.nlm.nih.gov). Пчелиный дефензин, также как шмелиный, был амилирован и имел дополнительное удлинение на 11 аминокислот с С-конца, что было несхоже с другими насекомыми. Оказалось, что роялизин очень активен против грамотрицательных бактерий и неэффективен против грамположительных. Также была описана антигрибковая активность пчелиного роялизина [5] и его антибактериальная активность к патогену Paenibacillus larvae, который является возбудителем болезни личинок пчел.
А.В.Львов и А.Г.Николенко (2000) обнаружили существование двух, ранее не известных, аллельных форм А и В фрагмента гена дефензина. J.Klaudiny с соавт. (2005) изучили нуклеотидную и аминокислотную последовательности гена дефензина 1 и показали, что обнаруженный ими антибактериальный пептид отличался от дефензина, описанного А.В.Львовым и А.Г.Николенко (2000), заменой T на A в положении 1471, которая приводила к аминокислотной замене Leu на His; отличался от дефензина, описанного K.Casteels-Johnson с соавт. (1994) нуклеотидными заменами GGAGT на TTAGA в положении 1507–1511, которые приводят к аминокислотной замене GlyVal на ValGly; отличался от роялизина, описанного S.Fujiwara с соавт. (1990), нуклеотидными заменами СG на TA в положении 1832–1833, которые приводят к аминокислотной замене Arg на Tyr. Кроме того, они показали, что ранее известные дефензин и роялизин были не чем иным, как полиморфными формами дефензина 1, тогда как обнаруженная ими новая последовательность гена дефензина 2 лишь на 55,8% сходна с последовательностью дефензина 1 и являлся геном новой формы дефензина. Дефензин 1 обладал уникальной среди артропод экзон-интронной структурой. Оба дефензина экспрессировались в голове и груди. Дефензин 1 обнаружен в гипофаренгиальных, мандибулярных и грудных слюнных железах пчел, тогда как дефензин 2 отсутствовал. Различная представленность этих генов отражает тканезависимую экспрессию дефензина.
Мы изучили вариабельность фрагмента гена дефензина ядерной ДНК в популяциях A.m.mellifera на Урале. В исследовании наблюдалось два аллеля этого локуса. Аллель В фрагмента гена дефензина ядерной ДНК встречался с частотой 0,14-0,25, а аллель А – с частотой 0,75-0,86. В работе А.В.Львова и А.Г.Николенко (2002) частота аллелей фрагмента гена дефензина ядерной ДНК в популяциях пчел на Урале распределялась более равномерно: аллель B встречался с частотой 0,25-0,45, а аллель A – 0,55-0,75. Для более детального сравнения можно показать, что работах А.В.Львова и А.Г.Николенко (2002) в западной и северо-восточной популяциях пчел на Урале частота встречаемости аллелей B и А фрагмента гена дефензина ядерной ДНК была 0,25 и 0,75, соответственно, в янаульской - 0,45 и 0,55, в бурзянской – 0,41 и 0,59, в иглинской – 0,32 и 0,68. В нашем исследовании в бурзянской и иглинской популяциях аллель В фрагмента гена дефензина ядерной ДНК встречался с частотой значительно меньшей таковых в работе А.В.Львова (2002). Различалось также распределение генотипов фрагмента гена дефензина ядерной ДНК в популяциях. В нашей работе генотип ВВ фрагмента гена дефензина ядерной ДНК встречался с частотой 0,06-0,11, генотип АА - 0,61-0,80, генотип АВ - 0,12-0,29, тогда как в работе А.В.Львова и А.Г.Николенко (2002) генотип ВВ встречался с частотой 0,00-0,28, генотип АА - 0,35-0,75, генотип АВ – 0,16-0,48.
Причину такого распределения аллелей и генотипов фрагмента гена дефензина ядерной ДНК на данный момент очень сложно однозначно объяснить, но можно предположить, что популяция пчел на Урале за несколько лет претерпела некоторые изменения, которые, возможно, связаны с особенностями организации и развития популяций пчел, как общественных насекомых, а также с глобальными изменениями экосистем и загрязнением окружающей среды.
Pathogenic bacteria bees are common in soil, water, air and food. In most cases, the bacteria enter the body cavity through the bees forage absorbable. The bacteria can infect the bees through spiracles, or even through the wound inflicted by external parasites - mites Varroa jacobsoni [1]. Any injury or cuticle of the digestive tract is input by bacteria.
Honeybee larvae may be affected by American foulbrood Paenibacillus larvae larvae, European foulbrood Mellissococcus pluton, Bacillus pulvifaciens, and adult bees - Pseudomonas aeruginosa, Hafnia alvei, Enterococcus faecalis. Saprophytic and plant pathogenic bacteria can also induce the disease of bees accidentally when released into the body cavity.
As is known, bees produce antimicrobial peptides to protect against microorganisms. At the moment, the bees are known antimicrobial peptides - abetsin, defensin and gimenoptetsin which in B.V.Zyumanu (1992), are essential components of group and individual bee colony immune system. CSMcCleskey, RMMelampy (1938) and H.Yamauchi (2001) demonstrated the antibacterial properties of royal jelly bee secreted by pharyngeal glands, which is active against bacteria and fungi. K.Casteels-Johnson et al. (1994) studied in the hemolymph of bees infected with Escherichia coli, four different types of antimicrobial peptides catalyst - apidatsin, gimenoptetsin, abetsin and defensin.
Defensin antimicrobial peptides brings together a large family of cysteine-rich catalytic antimicrobial peptides that act on a variety of micro-organisms that make up the bulk of most organisms defense system. Defensins bees - 36-51 amino acid long peptides having sequence similarity, the main structure consisting of repeats terminal amino acid alpha-helices and two antiparallel chains, stabilized by 3 disulfide bridges [2]. Defensins typically produced last of all, but its activity continues for more than two weeks after infection [3]. Defensin hemolymph and its precursor pro-peptide have been characterized by cDNA isolated from abdominal cavity of infected bees [4].
Another defensin bees called royalizinom was isolated from royal jelly and bee was characterized S.Fujiwara et al. (1990) at the level of peptides. Both defensin bees contained 51 amino acids. They differ by one amino acid and the group consisting of two amino acids when comparing the sequences shown in international GeneBank (http://www.ncbi.nlm.nih.gov). Beeswax defensin, as hornet was amilirovan and had an elongation of 11 additional amino acids to the C-terminus that was dissimilar to other insects. It turned out that royalizin very active against Gram-negative bacteria and is ineffective against Gram-positive. Also described antifungal activity of bee royalizina [5] and its antibacterial activity to a pathogen Paenibacillus larvae, that is larvae bee pathogen.
A.V.Lvov and A.G.Nikolenko (2000) found the existence of two previously unknown, allelic forms A and B gene fragment of defensin. J.Klaudiny et al. (2005) examined the nucleotide and amino acid sequences defensin 1 gene and showed that they have detected an antibacterial peptide differed from defensin described A.V.Lvovym and A.G.Nikolenko (2000), by replacing T with A at position 1471, which resulted in amino acid substitution of Leu for His; different from the defensin described K.Casteels-Johnson et al. (1994) at nucleotide substitutions GGAGT TTAGA at position 1507-1511, which result in an amino acid substitution at GlyVal ValGly; different from royalizina described S.Fujiwara et al. (1990), nucleotide substitutions CG to TA at position 1832-1833, which result in amino acid substitution of Arg for Tyr. In addition, they showed that the previously known defensin and royalizin were nothing like polymorphs defensin 1, whereas they discovered a new gene sequence defensin 2 by only 55.8% similar to the sequence of defensin 1 and was a new form of defensin gene. Defensin 1 possessed unique among arthropods exon-intron structure. Both defensin expressed in the head and chest. 1 defensins found in gipofarengialnyh, mandibular and thoracic salivary glands of bees, while defensin 2 was absent. Different representations of these genes reflects tkanezavisimuyu defensin expression.
We have studied the variability of defensin gene fragments of nuclear DNA in populations Ammellifera the Urals. The study observed the two alleles of this locus. Alleles in the gene fragment of defensin nuclear DNA occurs with a frequency 0,14-0,25 and allele - with the frequency of 0,75-0,86. The paper A.V.Lvova and A.G.Nikolenko (2002), the frequency of allele gene fragment of defensin nuclear DNA in populations of bees in the Urals are more evenly distributed: B allele occurs with a frequency 0.25-0.45, and allele A - 0 , 55-0,75. For a more detailed comparison, we can show that works and A.V.Lvova A.G.Nikolenko (2002) in the western and north-eastern populations of bees in the Urals, the frequency of allele B and A gene fragment of defensin nuclear DNA was 0.25 and 0 , 75, respectively, YANAULSKY - 0.45 and 0.55, in Burzyan - 0.41 and 0.59, in Iglinsky - 0.32 and 0.68. In our study, in Burzyan and Iglinsky allele in populations defensin gene fragment nuclear DNA occurs with a frequency significantly lower than that in the A.V.Lvova (2002). Also differ in the distribution of genotypes defensin gene fragments of nuclear DNA in populations. In our work genotype BB defensin gene fragment nuclear DNA met frequency 0,06-0,11 genotype AA - 0,61-0,80 genotype AB - 0,12-0,29, whereas the AV .Lvova and A.G.Nikolenko (2002) met with BB genotype frequency of 0,00-0,28, genotype AA - 0,35-0,75, genotype AB - 0,16-0,48.
The reason for this distribution of alleles and genotypes of defensin gene fragments of nuclear DNA at the moment is very difficult to clearly explain, but it can be assumed that the population of bees in the Urals, in a few years has undergone some changes that may be associated with features of the organization and development of populations of bees, both public insects, as well as global changes of ecosystems and environmental pollution.
  031. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Филогенетика и структура популяции пчел на Урале. Материалы докладов молодежной научной конференции: "Экологические проблемы Севера". Архангельск. 2008. С. 179-182.

Темная европейская или среднерусская пчела (подвид Apis mellifera mellifera L.) до вмешательства человека занимала почти всю Северную Европу. В Европе и России подвид A.m.mellifera был подвержен интенсивной гибридизации благодаря завозу пчел из Южной и Восточной Европы, в результате чего были утрачены его ценные качества. А.В.Петухов с соавт. (1996) и А.Г.Николенко и А.В.Поскряков (2002) показали возможность сохранения популяции A.m.mellifera на Урале.
Для определения настоящего состояния популяций среднерусской пчелы на Урале мы использовали ПЦР-анализ полиморфизма двух микросателлитных локусов ар243 и 4а110 ядерной ДНК, фрагмента гена второй субъединицы NADH-дегидрогеназы (ND2) и локуса, расположенного между генами цитохром оксидазы I и II (межгенный локус COI-COII) митохондриальной ДНК (мтДНК). Были проанализированы пчелы из 550 семей с 11 пасек 3 районов Республики Башкортостан и с 11 пасек 7 районов Пермского края.
Ранее было показано (Cornuet et al., 1991), что подвиду A.m.mellifera соответствует комбинация элементов PQQ межгенного локуса COI-COII, а южным подвидам (Apis mellifera ligustica Spinola, Apis mellifera caucasica Gorbatschev и Apis mellifera carnica Pollmann) – только один элемент Q. Пчелы с пасек Уинского района Пермского края и Иглинского района Республики Башкортостан характеризовались относительно низкой частотой встречаемости комбинации PQQ 0,71 и 0,57, соответственно, что вызвано, несомненно гибридизацией. Иглинская популяция также, в целом, оказалась гибридной, хотя пасеки Кугейко и Орловская характеризовались довольно высокой частотой встречаемости комбинации PQQ (0,90 и 0,93, соответственно). Вместе с тем данные пасеки не могли быть отнесены к популяции A.m.mellifera, так как расположены в массовом окружении пасек с гибридными семьями, между которыми возможен интенсивный поток генов. Наиболее высокой частотой встречаемости комбинации PQQ (свыше 0,98) характеризовались пасеки Вишерского района Пермского края - вишерская популяция A.m.mellifera, пасеки Нытвенского, Пермского, Ординского, Осинского и Частинского районов Пермского края - южно-прикамская популяция A.m.mellifera, пасеки и борти Бурзянского района Республики Башкортостан - бурзянская популяция A.m.mellifera, а также пасеки Татышлинского района Республики Башкортостан - татышлинская популяция A.m.mellifera. Высокий уровень частоты встречаемости комбинации PQQ на пасеках позволяет говорить о существовании на данный момент, как минимум, четырех сохранившихся популяций A.m.mellifera на Урале: вишерской, южно-прикамской, татышлинской и бурзянской.
Обнаружение четырех сохранившихся популяций A.m.mellifera на Урале позволило нам приступить к следующей задаче – генетической характеристике этих популяций на основе микросателлитных локусов 4a110 (Haberl, Tautz, 1999) и ap243 (Solignac et al., 2003) ядерной ДНК. Как известно, микросателлитные маркеры позволяют выявлять генетическую дифференциацию близкородственных популяций или экологических групп одного вида, а также подвидов (Bernatchez et al., 1998; Brunner et al., 1998, Primmer et al., 1999). В качестве контроля была использована уже точно известная гибридная иглинская, объединяющую пасеки иглинского района Республики Башкортостан, а также уинскую популяции, состоящую из пасек Уинского района Пермского края.
Мы изучили вариабельность микросателлитных локусов ap243 и 4а110 ядерной ДНК в популяциях пчел на Урале. По критерию значимости Пирсона χ2 и вероятности Р только одна вишерская популяция находилась в равновесии, вероятность Р которой равна 0,173. Во всех остальных популяциях P<0,05.
Генетические расстояния Cavalli-Sforza and Edwards между всеми популяциями пчел на Урале изменялись от 0,043 между Бурзянской и Уинской до 0,212 между Татышлинской и Иглинской популяциями. На основе полученных генетических расстояний была построена дендрограмма с использованием метода кластеризации ближайшего соседа, графически отображающая генетические отношения между популяциями, на которой Иглинская популяция располагалась отдельно от всех остальных популяций, что, возможно, являлось следствием гибридизации. Уинская популяция, ранее определенная по митохондриальной ДНК как гибридная, по микросателлитным локусам ядерной ДНК характеризовались, как A.m.mellifera, причем была очень сходной с Бурзянской популяцией. Такое явление можно объяснить миграцией трутней с соседних пасек Уинского района Пермского края, в которых высокое содержание A.m.mellifera, например, с пасек из описанных ранее А.В.Петуховым в заказнике «Малиновый хутор». Среди популяций наблюдалась определенная группировка, где Татышлинская была наиболее генетически близка к Южно-Прикамской, а Вишерская, Бурзянская и Уинская были наиболее сходны между собой. Следует отметить, что наблюдаемая дифференциация очень незначительная, по сравнению с дифференциацией Иглинской популяции. Таким образом, по ядерной ДНК подтверждается особенность Уинской популяции, ранее описанная А.В.Петуховым и опровергнутая нами по данным митохондриальной ДНК. Возможно, что в Уинском районе Пермского края в заказнике «Малиновый Хутор» сохранилась еще одна популяция A.m.mellifera.
Коэффициент дифференциации Fst (Cockerham, 1973; Weir, Cockerham, 1984) между популяциями изменялись в пределах от -0,001 до 0,171. Наименее дифференцированными были Вишерская и Бурзянская, Татышлинская и Южно-Прикамская, Бурзянская и Уинская, значения Fst которых были очень близки к 0. Наиболее дифференцированной от всех была Иглинская популяция, значения Fst которой изменялись от 0,076 между Бурзянской и Иглинской до 0,171 между Татышлинской и Иглинской. Значения Fst значительно коррелируют с генетическими расстояниями, однако значения Fst тут приводятся для возможности сопоставления с другими данными, так как во многих публикациях приводится только матрица Fst, на основе которой и строится дендрограмма. Наблюдаемая гетерозиготность Ho немного меньше ожидаемой гетерозиготности для субпопуляций Hs и всей популяции Ht, что свидетельствует о дефиците гетерозигот. Дефицит гетерозигот также показывает и положительное значение коэффициента инбридинга для субпопуляций Fis и тотальной популяции Fit. Кроме того, значения Fis и Fit являются показателями незначительного отклонения распределение генотипов от равновесия Харди-Вайнберга всей популяции пчел на Урале (при равновесии Харди-Вайнберга значение Fis и Fit равно 0). Коэффициент дифференциации для всей популяции пчел на Урале Fst имеет близкое к 0 значение, что является показателем очень незначительной генетической дифференциации популяций.
В ходе секвенционного анализа амплифицированного фрагмента гена ND2 мтДНК медоносной пчелы была определена его нуклеотидная последовательность со средним размером 688 п.н. Нуклеотидные последовательности просеквенированных фрагментов гена ND2 мтДНК пчел были депонированы в международный генбанк NCBI (http://www.ncbi.nlm.nih.gov) (Ilyasov et al., 2005; Ilyasov et al., 2006). При сравнении по данной последовательности уральских пчел A.m.mellifera наблюдалось 5 нуклеотидных замен., где замена Т на С в позиции 536 двух уральских пчел DQ181614 и DQ181618 приводила к замене в аминокислотной последовательности в положении 12 аминокислоты изолейцин (Ile) на треонин (Thr). На дендрограмме, построенной по результатам сравнения нуклеотидных последовательностей фрагмента гена ND2 не наблюдалось дифференциации между представителями разных локальных популяций A.m.mellifera на Урале, что является показателем их тесного генетического родства. В дальнейшем нами сравнивались последовательности A.m.mellifera уральских популяций со всеми доступными в генбанке NCBI последовательностями большинства подвидов A.mellifera. На полученной дендрограмме наблюдалась группировка образцов на четыре эволюционные ветви, сходная с подразделением подвидов A.mellifera, предложенного F.Ruttner et al. (1978). Однако по подвидовому составу групп наблюдались различия. Подвидовой состав четырех эволюционных ветвей предложенных M.C.Arias, W.S.Sheppard (1996), P.Franck et al. (2000) с использованием этого же локуса оказался очень похожим на наш.
Представители уральских и европейских популяций A.m.mellifera кластеризовались в одну группу, названную эволюционной ветвью М. Но от ветви М, предложенной F.Ruttner et al. (1988), она отличалась тем, что в ее состав вошел только один единственный подвид - A.m.mellifera. Большинство представителей африканских подвидов пчел объединились во вторую группу, названную эволюционной ветвью А, по аналогии с F.Ruttner et al. (1988), хотя по составу подвидов наблюдались определенные различия. Эта ветвь разделилась на две подгруппы, объединяющие северо-африканские и южно-африканские подвиды, что сходно с группировкой M.C.Arias, W.S.Sheppard (1996). Однако, в отличие от группировки последних авторов, мы еще наблюдали третью африканскую группу, объединяющую пчел Центральной Африки - Apis mellifera adansonii Latreille из Сенегала и Apis mellifera scutellata Lepeletier из Кении. От основания ветви А отделилась небольшая группа, куда вошли Apis mellifera meda Skorikov из Сирии, Apis mellifera syriaca Buttel-Reepen из Сирии и Apis mellifera lamarckii Cockerell из Египта, названная эволюционной ветвью О. Эта ветвь по составу подвидов также имела отличия от ветви О, предложенной F.Ruttner et al. (1988). В четвертую многочисленную группу, названную эволюционной ветвью С, вошли пчелы Средиземноморья, Ближнего Востока и Кавказа. Эта эволюционная ветвь по составу подвидов отличалась от состава ветви С, предложенного F.Ruttner et al. (1988). Сравнительный анализ нуклеотидной последовательности фрагмента гена ND2 мтДНК подвидов A.mellifera и двух видов пчел Apis cerana Fabricius и Mellipona bicolor Lepeletier показал, что наиболее близкими к предковой форме вида A.mellifera являлись представители эволюционной ветви С. Также было показано, что Apis cerana не является предковым видом по отношению к A.mellifera: они относятся друг к другу как сестринские виды.
Таким образом, на основе анализа митохондриальной ДНК были выделены 4 сохранившиеся популяции A.m.mellfera на Урале: бурзянская, татышлинская, южно-прикамская и вишерская. Привлечение микросателлитных локусов ядерной ДНК позволило предположить, что в Уинском районе Пермского края имеется большая вероятность сохранения популяций A.m.mellfera. Детальное исследование пчел этого района, возможно, позволит нам выделить пятую сохранившуюся популяцию A.m.mellfera на Урале. По генетическим характеристикам, Уинская популяция наиболее сходна с Бурзянской популяцией A.m.mellfera. В целом, популяции A.m.mellfera на Урале характеризуются незначительной генетической дифференциацией, отклонением от равновесия Харди-Вайнберга, которое является, возможено результатом небольшого инбридинга в популяциях, что характерно для большинства пчел. Филогенетический анализ по локусу мтДНК показал генетическое родство уральских и западноевропейских популяций A.m.mellifera. Возможно, что подвид A.m.mellifera является единственным представителем внутривидовой эволюционной ветви М, а предковой формой подвидов Apis mellifera L. могут быть пчелы эволюционной ветви С.
Dark or the European Central Russian bee (subspecies Apis mellifera mellifera L.) to human intervention occupied almost the whole of Northern Europe. In Europe and Russia subspecies Ammellifera was subject to intense hybridization due to deliver their bees from Southern and Eastern Europe, resulting in lost his valuable quality. A.V.Petuhov et al. (1996) and A.G.Nikolenko and A.V.Poskryakov (2002) have shown the ability to maintain the population Ammellifera the Urals.
To determine the population status of the Central Russian bees in the Urals, we used PCR analysis of microsatellite loci polymorphism two ar243 4a110 and nuclear DNA gene fragment of a second subunit of NADH-dehydrogenase (ND2) and locus located between the genes cytochrome oxidase I and II (intergenic locus COI- COII) mitochondrial DNA (mtDNA). Bees were analyzed from 550 families with 11 apiaries 3 districts of the Republic of Bashkortostan and 11 apiaries 7 districts of Perm region.
It was shown earlier (Cornuet et al., 1991), which corresponds to the subspecies Ammellifera combination of elements PQQ intergenic locus COI-COII, and southern subspecies (Apis mellifera ligustica Spinola, Apis mellifera caucasica Gorbatschev and Apis mellifera carnica Pollmann) - only one element Q . Bee apiaries with Uinskogo district of the Perm Region and the Republic of Bashkortostan iglinsky district characterized by a relatively low incidence of a combination of PQQ 0,71 and 0.57, respectively, which caused no doubt by hybridization. Iglinskiy population as well as a whole, was a hybrid, though apiary Kugeiko and Orel were characterized by a relatively high incidence of combination PQQ (0,90 and 0,93 respectively). However, data apiary could not be attributed to population Ammellifera, because they are located in large apiaries surrounded hybrid families between which the intense gene flow. The highest incidence of the combination PQQ (over 0.98) were characterized apiary Vishera district of the Perm region - Visherskaya population Ammellifera, apiary Nytvensky, Perm, Orda, Osa and Perm Territory Chastinskogo areas - South Prikamskaya population Ammellifera, apiary and board Burzyansky area Republic of Bashkortostan - Burzyan population Ammellifera, and apiary Tatyshlinskogo district of Bashkortostan - tatyshlinskaya population Ammellifera. The high level of incidence of a combination of PQQ on apiaries suggests the existence of at the moment, at least, the four remaining populations of the Urals Ammellifera: Vishera, Kama region of the South, and tatyshlinskoy Burzyan.
Finding four remaining populations in the Urals Ammellifera allowed us to proceed to the next task - the genetic characteristics of these populations based on microsatellite loci 4a110 (Haberl, Tautz, 1999) and ap243 (Solignac et al., 2003) of nuclear DNA. It is known that microsatellite markers allow detection of closely related genetic differentiation of populations or environmental groups of one species and subspecies (Bernatchez et al., 1998; Brunner et al., 1998, Primmer et al., 1999). As a control was used already known hybrid Iglinskiy uniting apiary iglinsky district of the Republic of Bashkortostan, as well as uinskuyu population consisting of apiaries Uinskogo district of the Perm region.
We have studied the variability of microsatellite loci ap243 4a110 and nuclear DNA in populations of bees in the Urals. On the criterion of the importance of the Pearson χ2 probability P and only one Visherskaya population is in equilibrium, the probability P is equal to 0.173. In all other populations P <0,05.
Genetic distances Cavalli-Sforza and Edwards among all populations of bees in the Urals varied from between 0,043 and Burzyan Uinskoy to between 0.212 and Tatyshlinskoy Iglinsky populations. On the basis of genetic distance dendrogram was built using the nearest neighbor method, clustering, graphically showing the genetic relationships between populations, which Iglinskiy population separate from the rest of the population, which may be a consequence of hybridization. Uinskaya population previously defined by the mitochondrial DNA as a hybrid, according to nuclear DNA microsatellite loci characterized as Ammellifera, and was very similar to Burzyan population. This phenomenon can be explained by migration from neighboring apiaries drones Uinskogo district of the Perm region, where high levels of Ammellifera, such as apiaries of the previously described A.V.Petuhovym in reserve "Raspberry Farm." Among the population there is a certain group where Tatyshlinskaya was the most genetically similar to the South-Kama region and Visherskaya, Burzyan and Uinskaya were the most similar. It should be noted that the observed differentiation very small compared with the differentiation Iglinsky population. Thus, nuclear DNA confirmed feature Uinskoy population previously described A.V.Petuhovym refute contact according to mitochondrial DNA. It is possible that in the near Uinskom Perm edge in the reserve 'Raspberry Farm "survived another population Ammellifera.
Differentiation factor Fst (Cockerham, 1973; Weir, Cockerham, 1984) between populations ranged from 0.001 to 0.171. The least differentiated and were Visherskaya Burzyan, Tatyshlinskaya and South Prikamskaya, Burzyan and Uinskaya, Fst values ​​were very close to 0. The most differentiated from all was Iglinskiy population, Fst values ​​that vary from between 0,076 and Burzyan Iglinsky to between 0.171 and Tatyshlinskoy Iglinsky . Fst values ​​significantly correlated with the genetic distances, but there are Fst values ​​to allow comparison with other data, as in many publications is only the matrix Fst, on the basis of which the constructed dendrogram. The observed heterozygosity Ho slightly less than expected heterozygosity for subpopulations and the entire population Hs Ht, indicating a deficit of heterozygotes. The deficit of heterozygotes, and also shows a positive coefficient of inbreeding for subpopulations Fis and total population Fit. In addition, the values ​​of Fis and Fit are indicative of a slight deviation of the distribution of genotypes from Hardy-Weinberg equilibrium of the entire population of bees in the Urals (in the Hardy-Weinberg equilibrium value of Fis and Fit is 0). Differentiation factor for the entire population of bees in the Urals has Fst value close to 0, which is indicative of very little genetic differentiation of populations.
During sekventsionnogo analysis amplified gene fragment ND2 mtDNA honeybee was determined its nucleotide sequence with an average size of 688 bp The nucleotide sequence of the gene fragment sequenced ND2 mtDNA bees were deposited at an international genebank NCBI (http://www.ncbi.nlm.nih.gov) (Ilyasov et al., 2005; Ilyasov et al., 2006). A comparison of the sequence of the Ural observed bees Ammellifera 5 nucleotide substitutions., Where the replacement of the T of C at position 536 of the two Ural bees DQ181614 and DQ181618 leads to the substitution in the amino acid sequence of the amino acid at position 12, isoleucine (Ile) to threonine (Thr). In the dendrogram constructed by comparing the nucleotide sequences of the gene fragment ND2 observed differentiation between different local populations Ammellifera in the Urals, which is indicative of their close genetic relationship. In the future, we compared the sequence Ammellifera Ural population with all available in the NCBI GenBank sequences of most subspecies A.mellifera. On the resulting dendrogram observed grouping samples into four evolutionary branch, similar to the division of subspecies A.mellifera, proposed F.Ruttner et al. (1978). However, the composition of teams subspecies observed differences. Part of the four subspecies of evolutionary branches proposed MCArias, WSSheppard (1996), P.Franck et al. (2000) using the same locus was very similar to ours.
The representatives of the Ural and European populations Ammellifera clustered into one group called evolutionary branch from the branch M. But M proposed F.Ruttner et al. (1988), it is different in that its composition entered only a single subspecies - Ammellifera. Most of the African sub-species of bees in the second group came together, called evolutionary branch A, by analogy with the F.Ruttner et al. (1988), although the composition of certain subtypes observed differences. This branch was divided into two subgroups, combining North African and South African subspecies, which is similar to grouping MCArias, WSSheppard (1996). However, unlike the latter group of authors, we have seen a third of the African Group combining the Central African bees - Apis mellifera adansonii Latreille from Senegal and Apis mellifera scutellata Lepeletier from Kenya. From the base of the branches and the Division of a small group which included Apis mellifera meda Skorikov Syria, Apis mellifera syriaca Buttel-Reepen from Syria and Apis mellifera lamarckii Cockerell of Egypt, called evolutionary branch O. This branch sub-species composition also had differences from branch Oh, proposed F.Ruttner et al. (1988). The fourth largest group, called evolutionary branches with, bee entered the Mediterranean, the Middle East and the Caucasus. This evolutionary branch composition subspecies differs from that of branches from the proposed F.Ruttner et al. (1988). Comparative analysis of the nucleotide sequence of the gene fragment ND2 mtDNA subspecies A.mellifera and two species of bees Apis cerana Fabricius and Mellipona bicolor Lepeletier showed that closest to the ancestral form A.mellifera species were representatives evolutionary branch C has also been shown that not the Apis cerana ancestral views with respect to A.mellifera: they refer to each other as sister species.
Thus, based on analysis of mitochondrial DNA have been allocated 4 Ammellfera keep the population in the Urals: Burzyan, tatyshlinskaya, South Prikamskaya and Visherskaya. Attraction nuclear DNA microsatellite loci suggested that in Uinskom district of Perm Krai there is a great probability of sustaining populations Ammellfera. A detailed study of the bees in the area, may allow us to identify the fifth Ammellfera keep the population in the Urals. Genetic characteristics Uinskaya population most similar to the population Burzyan Ammellfera. Overall, the population in the Urals Ammellfera characterized by low genetic differentiation, deviation from Hardy-Weinberg equilibrium, which is possible result of inbreeding in small populations, which is typical for the majority of bees. Phylogenetic analysis of mtDNA locus showed the genetic relationship of the Urals and Western European populations Ammellifera. Perhaps Ammellifera subspecies is the only representative of intraspecific evolutionary branches of M and the ancestral form of the subspecies Apis mellifera L. bees may be evolutionary branch C.
  032. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Генетическая характеристика популяций пчел Республики Башкортостан. Материалы XV Всероссийской молодежной научной конференции "Актуальные проблемы биологии и экологии". Сыктывкар. 2008. Т. 3. С. 102-103.  

Вид пчелы A.mellifera L. естественный ареал которого - западная палеарктика и почти вся афротропическая зоогеографическая область, подразделяется на 25 подвидов. Ареал распространения медоносных пчел в Европе за последний век был подвержен значительным изменениям под воздействием человека. В Северной Европе с начала 20 века в коммерческом пчеловодстве стали преобладать A.m.ligustica из Италии и A.m.carnica из бывшей Югославии [4]. В Германии массовая интродукция привела к тому, что местный подвид A.m.mellifera был почти полностью заменен подвидом A.m.carnica. В скандинавских странах и Великобритании большинство пчеловодов содержат A.m.ligustica, A.m.carnica. На Урал также массово завозились пчелы с Кавказа - A.m.caucasica. В результате таких интродукций популяции местных пчел A.m.mellifera потеряли свою индивидуальность из-за гибридизации. Естественный ареал A.m.mellifera в результате значительно сократился.
Результаты предыдущих исследований европейских популяций пчел с использованием микросателлитных локусов и RFLP митохондриальной ДНК (мтДНК) [3] показали, что популяции на территории Франции, Германии, Испании, Дании и Норвегии являлись частично гибридизованными между A.m.mellifera и каким-либо подвидом из Восточной Европы или Средиземноморья. Однако им все же удалось обнаружить сохранившиеся популяции A.m.mellifera.
Результаты исследований популяций пчел на Урале с использованием морфометрических методов показали, что большинство из них состоят из гибридных семей. Однако, предполагали, что популяции аборигенного подвида могли сохраниться на территории Бурзянского, Янаульского районов республики Башкортостан, а также Уинского и Вишерского районов Пермского края. Результаты дальнейших исследований популяций пчел Урала с использованием маркера COI-COII мтДНК показали, что в Бурзянскогм районе действительно сохранилась аборигенная популяция A.m.mellifera [1].
В данной работе была поставлена цель сравнить две популяции пчел на Урале - сохранившуюся популяцию A.m.mellifera Бурзянского района - бурзянскую популяцию и гибридную популяцию пчел из Иглинского района - иглинскую популяцию на основе генетических показателей, полученных с использованием микросателлитных локусов 4a110 и ap243.
Были проанализированы пчелы из 50 семей иглинской и 62 семей бурзянской популяций с использованием микросателлитных локусов ap243 и 4a110. Микросателлитный локус ap243 содержит три аллеля, которые в бурзянской популяции встречались в соотношении 0,452: 0,315: 0,234, а в иглинской - 0,770: 0,160: 0,070. Микросателлитный локус 4a110 содержит два аллеля, которые в бурзянской популяции встречались в соотношении 0,581: 0,419, а в иглинской - 0,710: 0,290.
Значение коэффициента инбридинга внутри субпопуляции (Fis) для бурзянской популяции было равно 0,421, а иглинской популяции - 0,177. Во взятых для сравнения популяциях A.m.mellifera Colonsay и Whitby в Великобритании, проанализированных A.B.Jensen с соавт [3] с использованием 11 микросателлитных локусов значение внутрипопуляционного инбридинга (Fis) было равно 0,003 и 0,024, соответственно. Положительное и близкое к 0 значение этого коэффициента показывает незначительный дефицит гетерозигот и инбридинг. Из этого можно сказать, что уровень инбридинга очень низок в европейских популяциях A.m.mellifera, а в бурзянской популяции инбридинг выше почти в два раза, чем в иглинской.
В бурзянской популяции наблюдаемая гетерозиготность Hо = 0,320, а ожидаемая гетерозиготность He = 0,565. В иглинской популяции наблюдаемая гетерозиготность Hо = 0,330, а ожидаемая гетерозиготность He = 0,400. таким образом, в обеих популяциях отмечается дефицит гетерозигот. Следует отметить, что в бурзянской популяции дефицит гетерозигот выражен в два раза сильнее, чем в иглинской, что может быть следствием обитания при длительной изоляции в горно-лесной географической зоне.
Коэффициент дифференциации популяций (Fst) между бурзянской и иглинской популяциями 0,080. Для сравнения, коэффициент дифференциации популяций (Fst), при анализе 11 микросателлитных локусов, между популяциями A.m.mellifera Colonsay и Whitby Великобритании 0,050. Отсюда видно, что дифференциация между бурзянской и иглинской популяциями по результатам анализа двух микросателлитных локусов несколько выше дифференциации популяций A.m.mellifera Великобритании.
Стандартная генетическая дистанция M.Nei (1972) (Ds) между иглинской и бурзянской популяциями была равна 0,080, а генетическая дистанция L.L.Cavalli-Sforza, A.W.F.Edwards (1967) (Dce) между бурзянской и иглинской популяциями была равна 0,152. Генетическая дистанция M.Nei (1978) между островными популяциями A.mellifera в Германии, расчитанная P.Neumann с соавт [4] , используя 4 микросателлитных локуса, между матками пчел популяций Baltrum и Langeoog была равна 0,029, а между трутнями - 0,436, то есть уровень дифференциации трутней выше уровня дифференциации маток. Генетическая дистанция L.L.Cavalli-Sforza, A.W.F.Edwards (1967), рассчитанная [2], используя 6 микросателлитных локусов, между популяциями A.m.ligustica из Италии и A.m.carnica из Югославии равна 0,510, а между популяциями A.m.ligustica из Италии и A.m.mellifera из Франции равна 0,680. Таким образом, генетические дистанции между бурзянской и иглинской популяциями были значительно меньше по сравнению с дистанциями между европейскими популяциями пчел.
Таким образом, на основе анализа вариабельности микросателлитных локусов 4а110 и ap243 были рассчитаны основные генетические характеристики для двух популяций пчел на Урале: гибридной иглинской и аборигенной бурзянской. Уровень дифференциации между бурзянской и иглинской популяциями оказался выше дифференциации между популяциями A.m.mellifera Colonsay и Whitby Великобритании. Одинаковым для обеих сравниваемых популяций был дефицит гетерозигот и инбридинг, хотя для бурзянской популяции эти показатели были несколько выше.
View bee A.mellifera L. natural range which - Western Palearctic and Afrotropical almost all zoogeographical region, subdivided into 25 sub-species. The area of ​​distribution of honey bees in Europe over the last century has been subject to significant changes under the influence of man. In Northern Europe since the early 20th century began to dominate commercial beekeeping Amligustica Amcarnica from Italy and from the former Yugoslavia [4]. In Germany, the introduction of mass led to the fact that the local subspecies Ammellifera was almost completely replaced by subspecies Amcarnica. In the Scandinavian countries and the UK, most beekeepers contain Amligustica, Amcarnica. In the Urals and massively imported bees from Caucasus - Amcaucasica. As a result of such introductions of local bee populations Ammellifera lost their identity due to hybridization. Ammellifera natural habitat as a result of significantly reduced.
Previous studies of European bee populations using microsatellite loci and RFLP of mitochondrial DNA (mtDNA) [3] showed that the population in France, Germany, Spain, Denmark and Norway were partially annealed between Ammellifera and some subspecies of Eastern Europe, or Mediterranean. However, they still managed to find extant populations Ammellifera.
The results of studies of bee populations in the Urals with morphometric methods have shown that most of them consist of hybrid families. However, it is assumed that the population of aboriginal subspecies could be preserved in the territory Burzyansky, Yanaulskogo areas of the Republic of Bashkortostan, as well as Uinskogo and Vishera districts of Perm region. The results of further studies of bee populations using the Urals marker COI-COII mtDNA showed that the area really Burzyanskogm preserved aboriginal population Ammellifera [1].
In this paper we set the goal to compare two populations of bees in the Urals - keep the population Ammellifera Burzyansky area - Burzyan population and hybrid populations of bees from iglinsky district - Iglinskiy population based on genetic indicators obtained using microsatellite loci and 4a110 ap243.
Bees were analyzed from 50 families and 62 families Iglinsky Burzyan populations using microsatellite loci and ap243 4a110. Microsatellite loci ap243 has three alleles, which Burzyan population occurs at a ratio of 0.452: 0.315: 0.234, and Iglinsky - 0.770: 0.160: 0.070. Microsatellite loci 4a110 contains two alleles that are Burzyan population occurs in a ratio of 0.581: 0.419, and Iglinsky - 0.710: 0.290.
The coefficient of inbreeding within the subpopulation (Fis) for Burzyan population was equal to 0.421, and Iglinsky population - 0.177. When taken to compare populations Ammellifera Colonsay and Whitby in the UK, analyzed ABJensen et al [3] using 11 microsatellite loci value intrapopulation inbreeding (Fis) was equal to 0.003 and 0.024, respectively. Positive and close to 0 value of this index shows a slight deficit of heterozygotes and inbreeding. From this it can be said that a very low level of inbreeding in European populations Ammellifera, and inbreeding in the population above Burzyan almost twice than Iglinsky.
In Burzyan population observed heterozygosity = 0.320 But, as expected heterozygosity He = 0,565. In Iglinsky population observed heterozygosity = 0.330 But, as expected heterozygosity He = 0,400. Thus, in both populations are deficient heterozygote. It should be noted that in Burzyan population heterozygote deficiency is expressed in two times stronger than Iglinsky, which may be a consequence of living in long-term isolation in the mountain forest geographical area.
Coefficient of population differentiation (Fst) between populations Burzyan and Iglinsky 0.080. For comparison, the coefficient of population differentiation (Fst), the analysis of 11 microsatellite loci between populations Ammellifera Colonsay and Whitby UK 0,050. This shows that the differentiation between populations Iglinsky Burzyan and on the analysis of two microsatellite loci slightly higher population differentiation Ammellifera UK.
Standard genetic distance M.Nei (1972) (Ds) between Iglinsky and Burzyan populations was equal to 0.080, and the genetic distance LLCavalli-Sforza, AWFEdwards (1967) (Dce) between Burzyan and Iglinsky populations was equal to 0.152. Genetic distance M.Nei (1978) among island populations A.mellifera in Germany calculate P.Neumann et al [4], using four microsatellite loci between populations of bees queens Baltrum and Langeoog was equal to 0.029, but between drones - 0.436, the there is a level above the level of the drones differentiation differentiation queens. Genetic distance LLCavalli-Sforza, AWFEdwards (1967) calculated [2], using 6 microsatellite loci between populations Amligustica from Italy and from Yugoslavia Amcarnica is 0.510 and between populations Amligustica from Italy and from France is Ammellifera 0.680. Thus, the genetic distance between populations Iglinsky Burzyan and were significantly less than the distance between the European bee population.
Thus, based on the analysis of variability of microsatellite loci and 4a110 ap243 were calculated for basic genetic characteristics of two populations of bees in the Urals: Iglinsky hybrid and native Burzyan. The level of differentiation between Burzyan and Iglinsky populations was higher differentiation between populations Ammellifera Colonsay and Whitby UK. The same for both populations was compared deficit of heterozygotes and inbreeding, although Burzyan population these figures were slightly higher.
  033. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Генетическая структура популяций пчел Урала и Поволжья. Материалы международной научно-практической конференции "Проблемы биологии, экологии, географии, образования: история и современность". Санкт-Петербург-Пушкин. 2008. С.76-78.

Ещё двести лет назад подвид Apis mellifera mellifera L занимал в Евразии огромную территорию вдоль северной границы естественного ареала вида. Эволюция его протекала в суровых климатических условиях, в результате чего выработалась исключительная зимостойкость и устойчивость к таким заболеваниям, как нозематоз, гнилец, падевый токсикоз. В результате массового завоза пчел из южных районов в лесную и лесостепную зоны России, прежний ареал пчелы среднерусской расы оказался заселен в основном пчёлами гибридного происхождения. К сожалению, в результате непрерывного импорта пчел с юга в северные регионы произошла массовая гибридизация пчёл.
Одним из основных условий сохранения генофонда являются методы его чёткой идентификации (Daly et al., 1991). Первоначально для этого использовался только анализ морфометрических признаков. Его основу заложил Г.А.Кожевников (1900), который сделал промеры длины хоботка пчел и предложил методику измерения их хитиновых частей. Современная морфометрическая классификация A.mellifera основывается на работах G.Goetze (1940), В.В.Алпатова (1948) и F.Ruttner et al. (1978). F.Ruttner (1988, 1992) с использованием мультивариантного анализа морфометрических признаков разработал метод отличения A.m.mellifera от других европейских подвидов, однако не смог найти четких морфометрических различий между A.m.iberica и A.m.mellifera. Н.И.Кривцов (1998) в своей работе представил стандарты размеров частей тела для подвида A.m.mellifera, используя которые можно довольно точно определить подвидовую принадлежность. Также стандарты морфометрии были получены в нашей лаборатории для подвида A.m.mellifera башкирской популяции (Саттаров, Николенко, 2002). Однако стало известно, что морфометрические методы часто не позволяют точно идентифицировать подвиды из-за сильной зависимости морфометрических характеристик пчел от условий окружающей среды и уровня внутривидовой гибридизации (Guzman-Novoa et al., 1994).
Впоследствии большинство исследователей пчел стало переходить на использование молекулярных маркеров, дающих более точные, однозначно интерпретируемые результаты по сравнению с морфометрическими методами. В нашем институте разработана методика быстрой PCR-идентификации подвида A.m.mellifera в Республике Башкортостан на основе полиморфизма межгенного локуса COI-COII мтДНК. Для определения подвидовой принадлежности популяции пчел был использован метод на основе определения полиморфизма межгенного локуса COI-COII митохондриальной ДНК, комбинация PQQ которого характеризует происхождение пчел от A.m.mellifera по материнской линии. Всего было проанализировано 69 семей пчел с 11 пасек Удмуртии, 144 семей с 11 пасек Пермского края и 406 семей 9 пасек Республики Башкортостан.
Результаты показали, что на части пасек Удмуртии преобладали семьи имеющие происхождение от A.m.mellifera. Частота пчел происходящих от A.m.mellifera была очень высокой на некоторых пасеках Камбарского, Глазовского, Можгинского, районов Удмуртии. В Мало-Пургинском, Шарканском и Завьяловском районах Удмуртии частота пчел происходящих от A.m.mellifera оказалась довольно низкой, что свидетельствует о завозе пчел южных подвидов. Найденные нами пасеки с высоким содержанием пчел происходящих от A.m.mellifera на территории Татышлинского района республики Башкортостан, возможно, являются сохранившейся частью янаульской популяции A.m.mellifera. Практически на всей территории Пермского края было обнаружено множество пасек с большинством семей, происходящих от A.m.mellifera. Эти пасеки расположены на территории Красновишерского, Нытвенского, Ординского, Частинского, Пермского, Осинского районов Пермского края. На территории Уинского района пермского края часть семей пчел имело гибридное происхождение. Возможно, что произошла некоторая степень гибридизации благодаря потоку генов извне в эти пасеки. Пчелы, обитающие на всей остальной территории, между изученными нами локальными популяциями, по ранним нашим исследованиям (Николенко, Поскряков, 2002), были интенсивно гибридизованы с завозными южными подвидами.
Таким образом, обнаруженные нами пасеки с высокой частотой встречаемости семьей пчел, имеющих происхождение от A.m.mellifera, позволяют говорить о сохранении на Урале локальных популяций темной лесной или среднерусской пчелы. Генетическая структура популяций пчел на Урале и Поволжье очень сложная, прерывистая и фрагментированная. Нет большого непрерывного массива генофонда пчел, происходящих от темной лесной пчелы, а островная модель популяции, описанная в 1969 году С. Райтом, оказалась для них очень подходящей. Между локальными популяциями происходит непрерывный поток генов как под воздействием антропогенных, так и естественных внутрипопуляционных факторов. Благодаря некоторой степени изоляции между ними происходит процесс дивергенции, что приводит к накоплению в популяции пчел происходящих от A.m.mellifera генетического разнообразия и тем самым повышает его устойчивость к факторам окружающей среды. Для сохранения популяции пчел, происходящих от A.m.mellifera, на Урале и Поволжье необходимо сохранить генофонд каждой из обнаруженных нами локальных популяций в чистоте и определенной изоляции от потока генов из популяций пчел гибридного происхождения.
More hundred years ago, a subspecies of Apis mellifera mellifera L held in the vast territory of Eurasia along the northern border of the natural range of the species. The evolution of his flowed in severe climatic conditions, resulting in a developed an exceptional winter hardiness and resistance to diseases such as nosema, foulbrood, honeydew toxicosis. As a result, the mass importation of bees from southern areas in the forest and steppe zones of Russia, the former area of ​​the Central Russian bee races were inhabited mostly by bees hybrid origin. Unfortunately, as a result of continuous import of bees from the south to the northern regions there was a mass of bees hybridization.
One of the main conditions for the preservation of the gene pool are methods of identifying a clear (Daly et al., 1991). Initially it was used only the analysis of morphometric characters. He laid the foundation G.A.Kozhevnikov (1900), who made measurements of the proboscis bees and proposed a method of measuring their chitin parts. Modern morphometric classification is based on the works of A.mellifera G.Goetze (1940), V.V.Alpatova (1948) and F.Ruttner et al. (1978). F.Ruttner (1988, 1992) using multivariate analysis of morphometric characters developed a method for distinguishing Ammellifera other European subspecies, but could not find a clear distinction between morphometric and Amiberica Ammellifera. N.I.Krivtsov (1998) in their work introduced standards for the size of body parts subspecies Ammellifera, using which you can quite accurately determine the subspecies. Also standard morphometry were obtained in our laboratory for the subspecies Ammellifera Bashkir population (Sattar, Nikolenko, 2002). However, it became known that the morphometric methods often do not accurately identify the subspecies of the strong dependence of morphometric characteristics of bees on the environment and the level of intraspecific hybridization (Guzman-Novoa et al., 1994).
Subsequently, most of the researchers was the bees to pass on the use of molecular markers, which give a more accurate, clearly interpretable results compared with morphometric methods. In our institute developed a method of rapid PCR-identification of subspecies Ammellifera in Bashkortostan-based polymorphism intergenic locus COI-COII mtDNA. To determine the subspecies bee population has been used a method based on the definition of polymorphism of the intergenic locus COI-COII mitochondrial DNA, which is characterized by a combination of PQQ origin of bees from Ammellifera maternal. There were analyzed 69 bee colonies from 11 apiaries Udmurtia, 144 families from 11 apiaries Perm region and 406 families 9 apiaries in the Republic of Bashkortostan.
The results showed that of the apiaries Udmurtia dominated family originating from Ammellifera. The frequency of bees originating from Ammellifera was very high in some apiaries Kambarka, Glazov, Mozhginsky, Udmurtia regions. The Little Purginskom, Sharkan and Udmurtia regions Zavyalovsky frequency of bees originating from Ammellifera was quite low, indicating that the importation of bees southern subspecies. We found high in the apiary bees Ammellifera originating from the territory of the Republic of Bashkortostan Tatyshlinskogo district are arguably preserved part of the population YANAULSKY Ammellifera. Almost the entire territory of Perm Krai was found many apiaries with most families originating from Ammellifera. These apiaries are located in Krasnovishersky, Nytvensky, Orda, Chastinskogo, Perm, Perm Krai Osa region. On the territory of Perm Krai Uinskogo area of ​​the bee colonies had a hybrid origin. It is possible that there was some degree of hybridization due to gene flow from the outside in the apiary. Bees living on the rest of the territory between the studied local populations, according to our earlier studies (Nikolenko, Poskryakov, 2002), have been extensively hybridized to imported from the southern subspecies.
Thus, we found an apiary with a high frequency of occurrence of bee family, originating from Ammellifera, allow to speak about the preservation of local populations in the Urals and Central Russia dark forest bees. The genetic structure of populations of bees in the Urals and the Volga region is very complicated, fragmented and discontinuous. There is a large array of continuous gene pool of bees originating from a dark forest bees and island population model described in 1969 by C. Wright, it was very suitable for them. Between local populations is a continuous gene flow under the impact of anthropogenic and natural factors intrapopulation. Due to some degree of isolation between the process of divergence, leading to the accumulation in the bee population originating from Ammellifera genetic diversity and thus increases its resistance to environmental factors. To save the bee population originating from Ammellifera, the Urals and the Volga region need to preserve the gene pool of each of the local populations we found clean and a certain isolation from the flow of genes from the bee populations of hybrid origin.
  034. Ильясов Р.А., Поскряков А.В., Филатов В.С., Николенко А.Г. Генофонд пчел Красноуфимского района Свердловской области. Материалы II Всероссийской научно-практической конференции "Экологические системы: фундаментальные и прикладные исследования". Нижний Тагил. 2008. Т. 1. С. 167-170

Генофонд пчел Красноуфимского района Свердловской области
Естественный ареал пчел подвида Apis mellifera mellifera L. распространяется от Великобритании вдоль всей Северной Европы до Уральских гор. Уральские горы оказались преградой для распространения пчел на восток в Азию, однако, благодаря вмешательству человека, пчелы получили возможность распространиться в Сибирь до Дальнего Востока. Широкому расселению пчел способствовали идеальные для подвида A.m.mellifera L. природные и климатические условия – территории, занятые лесами и лесостепями с обильной медоносной растительностью в условиях континентального климата. В России наиболее известны такие регионы пчеловодства, как Алтай, Поволжье, Южный и Средний Урал. На Урале наиболее славятся пчеловодством Республика Башкортостан, Пермский край и Свердловская область, а в Поволжье - Республика Татарстан и Удмуртия (Кривцов, 1995).
В Свердловской области на сегодняшний день насчитывается около 46 тысяч пчелиных семей, которые принадлежат в основном частным хозяйствам. Крупных пчеловодческих хозяйств в области нет. Пчеловодство значительно развито на юго-западе Свердловской области - в Красноуфимском, Ачитском и Артинском районах, которые имеют сходные рельефные, ландшафтные и экологические условия (Филатов, 2004). Как известно, пчелы очень чувствительны к загрязнению окружающей среды, поэтому в местах с неблагополучной экологией, таких как окрестности городов Асбест, Краснотурьинск, Первоуральск, пчеловодство довольно плохо развито, так как регулярно происходит массовая гибель пчел.
Известно, что ранее на юго-западе Свердловской области содержали пчел подвида A.m.mellifera, которые были завезены из Предуралья через Пермь и Кунгур и с юга из Башкортостана с переселенцами. Эти пчелы отличались устойчивостью к продолжительным холодным зимам, многим болезням пчел и идеальной приспособленностью к жизни в местных условиях (Филатов, 2004).
Для успешного решения сельскохозяйственных задач в этом регионе с 1940-х по 1960-е годы были массово завезены южные подвиды пчел с Кавказа. С 1970-х по 1990-е годы были завезены карпатские пчелы из Мукачевского пчелопитомника. В 1990-х годах туда также были завезены пчелы Кубани и из Узбекистана (Филатов, 2004). Таким образом, на сегодняшний момент большинство семей пчел на юго-западе Свердловской области оказались гибридизованными с южными подвидами, в результате чего были потеряны многие ценные качества местных среднерусских пчел подвида A.m.mellifera.
Нами были проанализированы рабочие пчелы из 50 семей 8 частных пасек Красноуфимского района Свердловской области (рис. 1), собранные в течение лета 2006 года. Для идентификации происхождения пчел по материнской линии мы использовали полиморфный локус COI-COII мтДНК (Никоноров с соавт., 1998), который у подвида A.m.mellifera имеет размер около 600 п.н. (комбинация PQQ), а у южных подвидов – A.m.caucasica, A.m.carnica, A.m.ligustica – около 350 п.н. (комбинация Q).
В результате анализа для каждой пасеки были рассчитаны частоты встречаемости семей пчел, имеющих происхождение от A.m.mellifera и содержащих комбинацию PQQ (табл. 1). Как оказалось, частота комбинации PQQ была для всего района в общем очень низкой, что еще раз подтверждает массовый завоз пчел из южных регионов. На пасеках Ю.М.Попова в д. Савиново, Г.А.Ватолина в д. Татарский Турыш и В.Ф.Васильева в д. Верхняя Ирга вообще не оказалось семей пчел, имеющих происхождение от среднерусских. Наоборот, все пчелиные семьи на пасеке Е.В.Чухарева в д. Татарский Турыш характеризовались происхождением от A.m.mellifera. Все остальные пасеки содержали от 13 до 60% семей пчел происходящих от среднерусских пчел подвида A.m.mellifera.
Таким образом, популяция пчел юго-запада Свердловской области, в частности, Красноуфимского района, является интенсивно гибридизованной с подвидами, завезенными из южных регионов России и ближнего зарубежья. В среднем по району только около 30% пчел имеют происхождение от подвида A.m.mellifera. По результатам этих исследований можно определить западную границу ареала популяции A.m.mellifera, которая проходит по хребтам Уральских гор, где в Зауралье обитают только гибридные пчелы, а в Предуралье еще сохранилась популяция аборигенных A.m.mellifera не подверженная массовой гибридизации (Ильясов с соавт., 2005, 2006).
The gene pool of bees Krasnoufimsky district of Sverdlovsk region
The natural habitat bee subspecies Apis mellifera mellifera L. extends along the whole of the UK in Northern Europe to the Ural Mountains. Ural Mountains proved a barrier to the spread of bees East Asia, however, thanks to the intervention of man, bees were able to spread to Siberia and the Far East. The wide dispersal of bees contributed ideal for Ammellifera L. subspecies natural and climatic conditions - territory occupied by forests and forest honey with abundant vegetation in a continental climate. In Russia, the most well-known regions such beekeeping as Altai, Volga, Southern and Middle Urals. In the Urals, the most famous beekeeping Republic of Bashkortostan, Perm and Sverdlovsk region and the Volga - Tatarstan and Udmurtia (Krivtsov, 1995).
In the Sverdlovsk region today, there are about 46 thousand bee families, who belong mostly to private farms. Large bee farms in the area do not. Beekeeping is a significant development in the southwest of the Sverdlovsk region - Krasnoufimsk, Achitskom and Artinsky areas that have similar relief, landscape and environmental conditions (Filatov, 2004). It is known that bees are very sensitive to pollution, so in areas with unfavorable environment, such as the surroundings of Asbestos, Krasnoturinsk, Pervouralsk, beekeeping rather poorly developed, as regularly occurs mass death of bees.
It is known that earlier in the southwest of the Sverdlovsk region contained bee subspecies Ammellifera, which were imported from across the Urals Perm and Kungur and south of Bashkortostan with the settlers. These bees are resistant to long cold winters, many diseases of bees and ideally suited to life in the local context (Filatov, 2004).
To successfully solve agricultural problems in the region from the 1940s to 1960's were massively brought the southern subspecies of bees from the Caucasus. From the 1970s to the 1990s were brought to the Carpathian bees from Mukachevo pchelopitomnika. In the 1990s there were also imported bees Kuban and Uzbekistan (Filatov, 2004). Thus, at the moment most of the bee colonies in the southwest of the Sverdlovsk region appeared hybridized with the southern subspecies, which resulted in losing a lot of valuable qualities of the local Central Russian bee subspecies Ammellifera.
We have analyzed the worker bees of the 50 families of 8 private apiaries Krasnoufimsky district of Sverdlovsk region (Fig. 1), collected during the summer of 2006. To identify the origin of bees through the maternal line, we used polymorphic locus COI-COII mtDNA (Nikonorov et al., 1998), which have Ammellifera subspecies has a size of about 600 bp (A combination of PQQ), and the southern subspecies - Amcaucasica, Amcarnica, Amligustica - about 350 bp (Combination of Q).
The analysis for each apiary were calculated incidence of bee colonies, originating from Ammellifera and containing a combination of PQQ (Table. 1). As it turned out, the combination of the frequency of PQQ has been for the entire region in general is very low, which again confirms the massive importation of bees from southern regions. On apiaries Yu.M.Popova in the village. Savinovo, G.A.Vatolina in the village. Turishev Tatar and V.F.Vasileva in the village. The top was not at all Saskatoon bee colonies, originating from Central Russia. On the contrary, all bee colonies in the apiary in the village E.V.Chuhareva. Turishev Tatar origin characterized by Ammellifera. All other apiary contain 13 to 60% of bee colonies originating from the Central Russian bee subspecies Ammellifera.
Thus, the population of bees southwest of the Sverdlovsk region, in particular, Krasnoufimsky area is extensively hybridized with the subspecies imported from the southern regions of Russia and neighboring countries. On average, the district only about 30% of bees have descended from the subspecies Ammellifera. The results of these studies can determine the western border area populations Ammellifera, which runs along the ridges of the Ural Mountains, which are found only in the Urals hybrid bees, and in the Urals region still keep the population of native Ammellifera not subject to mass hybridization (Ilyasov et al., 2005, 2006 ).
  035. Ильясов Р.А. , Поскряков А.В., Колбина Л.М., Николенко А.Г. Характеристика пчел республики Удмуртия. Материалы международной научной конференции "Проблемы биоэкологии и пути их решения". Саранск. 2008. С. 142-144.

ХАРАКТЕРИСТИКА ПЧЕЛ РЕСПУБЛИКИ УДМУРТИЯ
Медоносная пчела Apis mellifera L. - уникальный объект сельского хозяйства. Помимо большого хозяйственного значения пчела является также интересным объектом научных исследований как представитель общественных насекомых. Медоносная пчела подвида Apis mellifera mellifera L. – пчела среднерусской расы в России наиболее из всех других подвидов приспособлена к жизни в условиях резко-континентального климата Евразии, что ставит задачу сохранения генофонда A.m.mellifera на первый план.
Для определения подвидового состава медоносных пчел морфометрическим методом было обследовано 515 пчелиных семей южных и центральных районов Республики Удмуртия (табл. 1). Из морфологических методов в наибольшем объеме использовались такие морфометрические признаки, как длина хоботка, кубитальный и тарзальный индексы, ширина третьего тергита, дискоидальное смещение.
Морфометрические исследования показали, что только 10% семей пчел принадлежат подвиду A.m.mellifera. Первый и основной шаг в восстановлении популяций A.m.mellifera в Удмуртской Республике – поиск сохранившихся популяций с использованием наиболее эффективных методов идентификации подвидов.
Для определения подвидовой принадлежности пчел с помощью молекулярно-генетических методов был использован полиморфизм межгенного локуса COI-COII митохондриальной ДНК (мтДНК), комбинация PQQ которого характеризует происхождение пчел от A.m.mellifera по материнской линии. Молекулярно-генетическим методом было проанализировано 69 семей пчел с 11 пасек 6 районов республики Удмуртия.
Результаты молекулярно-генетических исследований показали, что на большинстве пасек преобладали семьи имеющие происхождение от A.m.mellifera. Частота комбинации PQQ была высокой (>0,95) на некоторых пасеках Можгинского и Завьяловского районов, а в большинстве других районах наблюдалась довольно низкая частота комбинации PQQ (<0.70), что свидетельствует о завозе пчел южных подвидов (табл. 2).
Результаты молекулярно-генетического и морфологического методов более чем на 66% совпали в Можгинском районе, а в Шарканском оказались диаметрально противоположены. Это позволяет утверждать о том, что популяция пчел Можгинского района действительно относится к подвиду A.m.mellifera, тогда как во всех остальных районах пчелы возможно гибридизованы с пчелами южных подвидов.
Таким образом, проведенные исследования показали также, что ни один из использованных методов не стоит абсолютизировать. Поскольку аборигенными пчелами для всего Поволжья, в том числе и Удмуртской Республике были среднерусские пчелы, то есть пчелы подвида Apis mellifera mellifera L, а завезенные семьи южных подвидов составляли небольшой процент от общего количества разводимых пчел, это привело к тому, что большая часть местных пчел имеет гибридизацию по мужской линии, которую использованный молекулярно-генетический метод, к сожалению, определить не может. С другой стороны большая вариабельность морфологических признаков появившаяся в результате гибридизации привела к тому, что часть помесных пчел может по экстерьеру соответствовать A.m.mellifera, не являясь таковой на самом деле. Поэтому достоверные результаты могут быть получены только при использовании как морфологических, так и молекулярно-генетических методов исследования, охватывающих не только митохондриальный, но и ядерный геномы.
A honey bee Apis mellifera L. - a unique facility agriculture. In addition to the great economic importance of the bee it is also an interesting subject of research as a representative of the social insects. Honeybee subspecies Apis mellifera mellifera L. - Central Russian bee races in Russia most of all the other subspecies adapted to life in conditions of sharply continental climate of Eurasia, which makes the task of preserving the gene pool Ammellifera to the fore.
To determine the composition of the honey bee subspecies morphometric method was examined 515 bee colonies of the southern and central regions of the Republic of Udmurtia (Table. 1). From morphological methods were used in the greatest amount of morphometric features such as the proboscis, tarsal and cubital index, the width of the third tergite, discoid offset.
The morphometric studies showed that only 10% of bee colonies belong to the subspecies Ammellifera. The first and basic step in restoring populations Ammellifera in the Udmurt Republic - find remaining populations using the most effective methods of identifying subspecies.
To determine the subspecies of bees using molecular genetic techniques was used polymorphism of the intergenic locus COI-COII mitochondrial DNA (mtDNA), which is characterized by a combination of PQQ origin of bees from Ammellifera maternal. Molecular genetic methods have been analyzed 69 bee colonies from 11 apiaries 6 regions of the republic of Udmurtia.
The results of the molecular genetic studies have shown that in most apiaries dominated family originating from Ammellifera. Frequency combination PQQ was high (> 0.95) in some apiaries Mozhginsky and Zavyalovsky areas, and in most other areas, there is quite a low frequency combination PQQ (<0.70), indicating that the importation of bees southern subspecies (Table. 2).
The results of molecular genetic and morphological methods for more than 66% in matched Mozhginsky area and Sharkan appeared diametrically opposed. This suggests that the population of bees Mozhginsky area really belongs to the subspecies Ammellifera, whereas in all other regions of the bees might hybridize with the southern subspecies of bees.
Thus, the studies also showed that none of the methods used is not absolute. Since the native bees for the whole Volga region, including the Republic of Udmurtia were Central Russian bees, ie bee subspecies Apis mellifera mellifera L, and the family of the southern subspecies imported accounted for a small percentage of the total farmed bees, this has led to the fact that most of the local bees a hybridization of the male line, which used molecular genetic techniques, unfortunately, can not be determined. On the other hand a large morphological variability of signs appear as a result of hybridization has led to the fact that part of the hybrid bees can fit on the exterior Ammellifera, not being such in reality. Therefore, accurate results can be obtained only by using both morphological and molecular genetic research methods, covering not only the mitochondrial, and nuclear genomes.
CHARACTERISTICS OF BEES FROM UDMURTIYA REPUBLIC
Summary. Our research was made on morphometric and genetics methods. For analysis we used bees from 584 colonies in Udmurtiya Republic. Morphometric analysis consist in measuring of tongue, cubital and tarsal index, third tergit width and discoidal shift. Genetics methods include analysis of intergenic locus COI-COII of mtDNA. We found little inconsistency between morphometric and genetics data. Probably bees in some regions of Udmurtiya had hybrid origin.
  036. Ильясов Р.А., Поскряков А.В., Филатов В.С., Николенко А.Г. Характеристика популяции пчел юго-запада Свердловской области. Пчеловодство. № 5. 2008. С. 18.  

Характеристика популяции пчел юго-запада Свердловской области (Characteristics of the bee population southwest of the Sverdlovsk region)
Популяция пчел юго-запада Свердловской области, в частности Красноуфимского района, разнородна. В среднем по району только около 30% пчел имеют происхождение от подвида А. т. mellifera. Результаты этих исследований показывают, что восточная граница ареала популяции А. т. mellifera проходит по хребтам Уральских гор: в Зауралье обитают только гибридные пчелы, а в Предуралье еще сохранилась популяция аборигенных пчел А. т. mellifera, не ставшая жертвой массовой гибридизации (Ильясов с соавт., 2005, 2006).
Bee population southwest of the Sverdlovsk region, in particular Krasnoufimsky area is heterogeneous. On average, the district is only about 30% of the bees are derived from the subspecies A. m. Mellifera. The results of these studies show that the eastern boundary of the range of the population of A. m. Mellifera runs along the ridges of the Ural Mountains: in the Urals found only hybrid bees, and in the Urals still remaining populations of native bees A. m. Mellifera, do not become a victim of mass hybridization.
Publication Name: Ilyasov R.A., Poskryakov A.V., Filatov VS Nikolenko A.G. Characteristics of the bee population southwest of the Sverdlovsk region. Russian journal of beekeeping. V. 5. 2008. P. 18-19.
  037. Шамсиева Э.Т., Ильясов Р.А. Исследование пчел в Республике Башкортостан. Материалы международной научно-практической конференции "Биология: теория, практика, эксперимент". Саранск. 2008. С. 197-198.  

Медоносная пчела Apis mellifera L. по современной классификации ПоДразделяется на 25 подвидов[2]. Подвид Apis mellifera mellifera L. занимал территорию вдоль северной границы естественного видового ареала, подвид оптимально приспособлен к жизни в Северной Европе и Азии
В последнее время произошла гибридизация пчел в Европе и России в результате чего практически невозможно было найти сохранившиеся популяции A.rn.mellifera. Однако имеются сведения о том, что в отдельных местах еще могли сохраниться популяции A.rn.mellifera [1].
Морфометрические методы не позволяют достоверно определять подвиды пчел в случае гибридизации, тогда как молекулярные методы оказались более пригодными.
Мы в лаборатории биохимии адаптивности насекомых Института биохимии и генетики УНЦ РАН исследовали популяции пчел северных районов Республики Башкортостан и обнаружили высокое содержание подвида A.rn.mellifera. Идентификацию подвида проводили на основе изучения локусов ядерной и митохондриальной ДНК. В результате проведенных исследований мы планируем найти другие сохранившиеся популяции A.rn.mellifera и определить их генетическую структуру.
A honey bee Apis mellifera L. in modern classification is subdivided into 25 sub-species [2]. The subspecies Apis mellifera mellifera L. occupied territory along the northern border of the natural habitat of the species, subspecies optimally adapted to life in Northern Europe and Asia
Recently, there was a hybridization of bees in Europe and Russia as a result it was almost impossible to find a surviving population A.rn.mellifera. However, there is evidence that in some places could still keep the population A.rn.mellifera [1].
Morphometric methods do not reliably determine the subspecies of bees in the case of hybridization, whereas molecular methods were more suitable.
We are in the biochemistry laboratory of adaptability insects Institute of Biochemistry and Genetics, Ufa Science explored the bee population of the northern regions of the Republic of Bashkortostan and found high levels of subspecies A.rn.mellifera. The identification of the subspecies was performed by examining the loci of nuclear and mitochondrial DNA. As a result of the research we plan to find other extant populations A.rn.mellifera and determine their genetic structure.
  038. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Изучение пчел северного Башкортостана. Вестник Мордовского университета. 2008. № 2. С. 136-137.  

Мы проанализировали популяции пчел некоторых северных районов республики Башкортостан – Балтачевского, Татышлинского и Аскинского. По результатам предварительных исследований мы получили представление о структуре распределения генов и генотипов в популяции.
Мы изучали популяции пчел трех северных районов республики – Балтачевского, Татышлинского и Аскинского и сравнивали с популяцией пчел Бурзянского района, которая расположена на территории заповедника Шульган-Таш. В исследовании было использовано 168 семей пчел, собранные в течение последних трех лет.
На основе анализа полиморфизма межгенного локуса COI-COII митохондриальной ДНК (мтДНК) была определена подвидовая принадежность семей пчел по материнской линии (Ильясов с соавт., 2007). Анализ микросателлитного локуса 4a110 позволил получить представление о структуре распределения генов и генотипов в популяциях.
Полимеразную цепную реакцию (ПЦР) проводили в термоциклере “Циклотерм” при оптимальной для праймеров температуре отжига. Амплификаты разделяли в агарозном геле с использованием TBE-буферного раствора и окрашивали бромистым этидием.
ДНК выделяли из мышц торакса фиксированных в 96%-ном этаноле пчел. Выделение проводили смесью гуанидинтиоцианат-фенол-хлороформа (Chomezynski, Sacchi, 1987).
Аллель 1 микросателлитного локуса 4a110 с наибольшей частотой 0,650 встречался в аскинской популяции, а с наименьшей частотой 0,444 – в балтачевской. Аллель 1 для тотальной популяции встречался с средней частотой 0,540, а аллель 2 – со средней частотой 0,460. Генотипическое распределение было следующим. Наибольшее частота гомозигот по аллелю 1 наблюдалась в аскинской популяции – 0,400, а наименьшая – в балтачевской – 0,194. Наибольшее частота гомозигот по аллелю 2 наблюдалась в балтачевской популяции – 0,306, а наименьшая – в аскинской – 0,100. Наибольшие частоты гетерозигот наблюдались в балтачевской и аскинской популяциях – 0,500, а наименьшая – в бурзянской – 0,387. Средняя частота гомозигот по 1аллелю 0,312, по 2 аллелю – 0,233, гетерозигот – 0,456.
Наблюдаемое распределение аллелей в популяции, по расчетам, находится в соответсвии с равновесным ожидаемым равновесием по Харди-Вайнбергу. Рассчитанные коэффициенты Fis и Fit указывают на процесс незначительного инбридинга в этой популяции, а процессы аутбридинга не наблюдаются. Анализ по локусу COI-COII мтДНК подтвердил принадежность этих пчел к подвиду A.m.mellifera. Татышлинская, аскинская и балтачевская популяции вместе составляют северо-башкирскую популяцию A.m.mellifera.
Таким образом, по предварительным оценкам, на севере Республики Башкортостан еще сохранилась популяция A.m.mellifera, обладающая стабильностью генофонда и изолированная от миграции генов из гибридных популяций. Механизмы изоляции могут быть совершенно разными, начиная от антропогенных факторов и заканчивая факторами абиотической среды.
We have analyzed the bee population of some northern areas of the Republic of Bashkortostan - Baltachevskogo, Tatyshlinskogo and Askin. According to the results of preliminary research we got an idea of ​​the structure of the distribution of genes and genotypes in the population.
We studied a population of bees the three northern regions of the republic - Baltachevskogo, Tatyshlinskogo and Askin and compared with the population of bees Burzyansky area, which is located on the reserve Shulgan-Tash. The study used 168 bee colonies, collected over the past three years.
Based on the analysis of polymorphism of the intergenic locus COI-COII mitochondrial DNA (mtDNA) has been defined subspecies prinadezhnost bee families on the maternal line (Ilyasov et al., 2007). Analysis of microsatellite loci 4a110 allowed to get an idea about the structure of the distribution of genes and genotypes in the population.
Polymerase chain reaction (PCR) was performed in a thermal cycler "Tsikloterm" at the optimum annealing temperature for the primers. Amplificate were separated by agarose gel electrophoresis using TBE-buffer and stained with ethidium bromide.
DNA was isolated from the thorax muscles fixed in 96% ethanol bees. Isolation was carried out with a mixture of guanidine thiocyanate-phenol-chloroform (Chomezynski, Sacchi, 1987).
Allele 1 microsatellite loci 4a110 with the greatest frequency 0.650 Askin met in a population, and the lowest rate of 0.444 - in baltachevskoy. Allele 1 for total population met the average frequency 0.540, and allele 2 - with an average of 0.460. Genotypic distribution was as follows. The highest frequency of homozygotes for allele 1 was observed in the population Askin - 0,400, and the lowest - in baltachevskoy - 0.194. The highest frequency of homozygotes for allele 2 was observed in baltachevskoy population - 0,306, and the lowest - in Askin - 0,100. The highest frequency of heterozygotes observed in populations baltachevskoy and Askin - 0,500, and the lowest - in Burzyan - 0.387. The average frequency of homozygotes for 1allelyu 0.312, 2 allele - 0.233, heterozygotes - 0.456.
The observed distribution of alleles in the population, according to estimates, is in accordance with the equilibrium expected equilibrium Hardy-Weinberg. Calculate the rate of Fis and Fit indicate a slight process of inbreeding in this population, and outbreeding processes are not observed. Analysis locus COI-COII mtDNA confirmed prinadezhnost these bees to the subspecies Ammellifera. Tatyshlinskaya, Askin and baltachevskaya populations together make up the north-Bashkir population Ammellifera.
Thus, according to preliminary estimates, in the north of the Republic of Bashkortostan has preserved population Ammellifera, the gene pool is stable and isolated from the migration of genes from hybrid populations. The mechanisms of isolation can be quite different, ranging from human factors and ending with the abiotic environment factors.
  039. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Методы идентификации подвида A.m.mellifera пчелы медоносной. Пчеловодство. № 8. 2008. С. 8-9.

Методы идентификации подвида A.m.mellifera пчелы медоносной (Identification methods A.m.mellifera honeybee subspecies)
Существует ряд методов идентификации подвида A. m. mellifera (темной европейской, или темной лесной, или среднерусской пчелы). Как можно заметить,что наиболее перспективный на сегодняшний день — метод секвенирования генома, а также методы, основанные на PCR. Наша лаборатория разработала комплекс методов для идентификации генофонда среднерусской пчелы и активно ведет работы по поиску сохранившихся популяций A. m. mellifera на территории всей России и их детальной генетической характеристике.
There are several methods to identify the subspecies A. m. mellifera (dark European, or a dark forest, or the Central Russian bees). As you can see, the most promising to date - the method of genome sequencing, as well as methods based on PCR. Our laboratory has developed a set of methods for the identification of the gene pool of the Central Russian bees and is actively working to find remaining populations of A. m. mellifera throughout Russia and their detailed genetic characterization.
Publication Name: Ilyasov R.A., Poskryakov A.V. Nikolenko A.G. Identification methods A.m.mellifera honeybee subspecies. Russian journal of beekeeping. V. 8. 2008. P. 8-9.
  040. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Микроэволюционные процессы в популяции пчел Apis mellifera mellifera L. (Hymenoptera, Apidae) на Урале. Материалы международной научно-практической конференции "Живые объекты в условиях антропогенного пресса". Белгород. 2008. С.79-80.

Естественный ареал пчел подвида Apis mellifera mellifera L. занимает почти всю Северную Европу, доходя до Уральских гор [Кривцов, 1982]. В последние 100 лет пчелы этого подвида подверглись интенсивному антропогенному влиянию и их ареал значительно сократился. Распространение этого подвида стало прерывистым и один из островков его распространения находится на Урале.
Поиск локальных популяций А. т. mellifera проводили методом ПЦР-анализа на предмет изучения структурного полиморфизма межгенного локуса COI-COII мтДНК. Ранее было показано, что подвиду А. т. mellifera соответствует комбинация элементов PQQ, а южным подвидам (A. mellifera ligustica Spinola, A. mellifera caucasica Gorbatschev и A. mellifera carnica Pollmann) - только один элемент Q. Результаты анализа показали, что частота встречаемости комбинации PQQ в уральских популяциях пчел варьировала от 0.57 до 1.00. Пчелы для исследования были отобраны из ряда пасек нескольких районов Республики Башкортостан и Пермского края.
Пчелы с пасек Уинского района Пермского края и Иглинского района Республики Башкортостан характеризовались частотой встречаемости комбинации PQQ 0.71 и 0.57, соответственно. Такое значение частоты комбинации PQQ в уинской популяции является показателем ее гибридизации, что противоречит заключению А. В. Петухова с соавт. [1996], проведенному на основе данных морфометрического метода.
Наиболее высокой частотой встречаемости комбинации PQQ характеризовались пасеки Вишерского района Пермского края - вишерская популяция А. т. mellifera, пасеки Нытвенского, Пермского, Ординского, Осинского и Частинского районов Пермского края - южно-прикамская популяция А. т. mellifera, пасеки и борти Бурзянского района Республики Башкортостан — бурзянская популяция А. т. mellifera, а также пасеки Татышлинского района республики Башкортостан — татышлинская популяция А. т. mellifera.
На основе анализа данных о вариабельности фрагмента гена дефензина и микросателлитных локусов ар243 и 4а110 были рассчитаны генетические расстояния D по М. Nei [1978] между популяциями пчел на Урале, которые изменялись в пределах от 0.005 до 0.116. Между популяциями А. m. mellifera генетические расстояния были в пределах от 0.005 до 0.031, тогда как между иглинской популяцией и популяциями А. т. mellifera генетические расстояния имели большие значения и изменялись в пределах от 0.049 до 0.116. Иглинская популяция оказалась наиболее удалена от популяций А. т. mellifera, тогда как между популяциями A. m. mellifera не наблюдалось статистически значимой генетической дифференциации.
Значение средней наблюдаемой гетерозиготности внутри субпопуляций Но=0354 меньше значения средней ожидаемой гетерозиготности субпопуляций Д?=0.471 и средней ожидаемой гетерозиготности всей подразделенной популяции Я/=0.477, что является показателем дефицита гетерозигот и инбридинга в локальных популяциях А. т. mellifera на Урале.
Таким образом, популяции А. т. mellifera на Урале в целом характеризовались отсутствием статистически значимой генетической дифференциации, а также небольшим инбридингом и дефицитом гетерозигот. Иглинская же популяция, как гибридная, характеризовалась значительной генетической дифференциацией от популяций А. т. mellifera.
The natural habitat bee subspecies Apis mellifera mellifera L. occupies almost the entire northern Europe, reaching the Ural Mountains [Krivtsov, 1982]. In the past 100 years this bee subspecies under intense anthropogenic impact and their area decreased significantly. The distribution of this subspecies was intermittent and one of the islands it is spread in the Urals.
Search local populations of A. m. Mellifera was performed by PCR analysis for the study of the structural polymorphism of the intergenic locus COI-COII mtDNA. Previously, it was shown that the subspecies A. m. Mellifera appropriate combination of elements PQQ, and the southern subspecies (A. mellifera ligustica Spinola, A. mellifera caucasica Gorbatschev and A. mellifera carnica Pollmann) - only one element of Q. The results showed that the frequency the occurrence of combinations of PQQ in the Ural populations of bees varied from 0.57 to 1.00. Bees for the study were selected from a number of apiaries in several areas of the Republic of Bashkortostan and the Perm region.
Bee apiaries with Uinskogo district of the Perm Region and the Republic of Bashkortostan iglinsky district characterized by a combination of frequency of occurrence PQQ 0.71 and 0.57, respectively. Such frequency combination in PQQ uinskoy population is an indicator of its hybridization, which contradicts the conclusion AV Petukhov et al. [1996] conducted on the basis of morphometric method.
The highest frequency of occurrence characterized by a combination of PQQ apiary Vishera district of the Perm region - Visherskaya population of A. m. Mellifera, apiary Nytvensky, Perm, Orda, Osa and Perm Territory Chastinskogo areas - South Prikamskaya population of A. m. Mellifera, apiary and board Burzyansky area Republic of Bashkortostan - Burzyan population A. m. mellifera, and apiary Tatyshlinskogo district of the republic of Bashkortostan - tatyshlinskaya population of A. m. mellifera.
Based on an analysis of data on the variability of defensin gene fragment and microsatellite loci and ar243 4a110 were calculated genetic distances D on M. Nei [1978] between the populations of bees in the Urals, which ranged from 0.005 to 0.116. Between the populations of A. m. mellifera genetic distances ranged from 0.005 to 0.031, while between Iglinsky populations and populations of A. m. mellifera genetic distances were of great importance and ranged from 0.049 to 0.116. Iglinskiy population was the most distant from the populations of A. m. Mellifera, while among populations A. m. mellifera not statistically significant genetic differentiation.
The value of the average observed heterozygosity in subpopulations = 0354, but less than the average expected heterozygosity subpopulations D = 0.471 and the average expected heterozygosity across the subdivided population I / = 0.477, which is a measure of the deficit of heterozygotes and inbreeding in the local populations of A. m. Mellifera in the Urals.
Thus, the population of A. m. Mellifera in the Urals in general characterized by a lack of statistically significant genetic differentiation, as well as a small inbreeding and lack of heterozygotes. Iglinskiy the population, as a hybrid, characterized by significant genetic differentiation of populations of A. m. Mellifera.
  041. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Мукимов Р.Ш. Пчелы северного Башкортостана – предварительный генетический анализ. Материалы международной научно-практической конференции "Актуальные вопросы энтомологии". Ставрополь. 2008. С. 253-255.  

Республика Башкортостан расположена на склонах Южного Урала и в основном расположена в Предуралье. Башкортостан характеризуется многообразием природных условий и ресурсов, что обусловлено его физико-географическим положением. Территория Республики, вытянутая с Севера на Юг, входит в пределы 4 географических зон умеренного пояса: смешанных лесов, широколиственных лесов, лесостепную, степную. Дикие пчелы являются неотъемлемым компонентом экосистем уральских горных смешанных липовых лесов (Петров, 1983).
Пчеловодство в Башкортостане - древний промысел коренного населения, имеющий глубокие исторические корни, тысячелетний опыт и традиции. Башкирская пчела, башкирский мёд с давних времён считались символами Башкортостана. Для сохранения башкирских пчел был принят Закон Республики Башкортостан «О пчеловодстве».
Мы изучали популяции пчел трех северных районов республики – Балтачевского, Татышлинского и Аскинского и сравнивали с популяцией пчел Бурзянского района (Николенко, Поскряков, 2002; Ильясов с соавт., 2007), которая расположена на территории заповедника Шульган-Таш. В исследовании было использовано 168 семей пчел, собранные в течение последних трех лет. По результатам предварительных исследований мы получили структуру распределения генов и генотипов в популяциях. Аллель 1 микросателлитного локуса 4a110 с наибольшей частотой 0,650 встречался в аскинской популяции, а с наименьшей частотой 0,444 – в балтачевской. Аллель 1 для тотальной популяции встречался с средней частотой 0,540, а аллель 2 – со средней частотой 0,460. Генотипическое распределение было следующим. Наибольшее частота гомозигот по аллелю 1 наблюдалась в аскинской популяции – 0,400, а наименьшая – в балтачевской – 0,194. Наибольшая частота гомозигот по аллелю 2 наблюдалась в балтачевской популяции – 0,306, а наименьшая – в аскинской – 0,100. Наибольшие частоты гетерозигот наблюдались в балтачевской и аскинской популяциях – 0,500, а наименьшая – в бурзянской – 0,387. Средняя частота гомозигот по 1 аллелю 0,312, по 2 аллелю – 0,233, гетерозигот – 0,456.
Наблюдаемое распределение аллелей в популяции, по расчетам, находится в соответсвии с равновесным ожидаемым равновесием по Харди-Вайнбергу. Рассчитанные коэффициенты Fis и Fit указывают на процесс незначительного инбридинга в этой популяции, а процессы аутбридинга не наблюдаются. Анализ по локусу COI-COII мтДНК подтвердил принадежность этих пчел к подвиду Apis mellifera mellifera L. Татышлинская, аскинская и балтачевская популяции вместе составляют северо-башкирскую популяцию A.m.mellifera.
Таким образом, по предварительным оценкам, на севере Республики Башкортостан еще сохранилась популяция A.m.mellifera, обладающая стабильностью генофонда и изолированная от миграции генов из гибридных популяций. Механизмы изоляции могут быть совершенно разными, начиная от антропогенных факторов и заканчивая факторами абиотической среды.
The Republic of Bashkortostan is located on the slopes of the Southern Urals and mostly located in the Urals. Bashkortostan is characterized by the diversity of natural conditions and resources, due to its physical and geographic location. The territory of the Republic, extended from north to south, comes within four geographic zones temperate zones: mixed forests, deciduous forests, forest-steppe, steppe. Wild bees are an integral component of ecosystems Ural mountain lime mixed forests (Simpson, 1983).
Beekeeping in Bashkortostan - the ancient craft of the indigenous population, which has deep historical roots, a thousand-year experience and traditions. Bashkir Bee, Bashkir honey since ancient times were considered symbols of Bashkortostan. To preserve the Bashkir bee was adopted Law of the Republic of Bashkortostan "On Beekeeping".
We studied a population of bees the three northern regions of the republic - Baltachevskogo, Tatyshlinskogo and Askin and compared with the population of bees Burzyansky area (Nikolenko, Poskryakov, 2002; Ilyasov et al., 2007), which is located on the reserve Shulgan-Tash. The study used 168 bee colonies, collected over the past three years. According to the results of preliminary research we got the structure of the distribution of genes and genotypes in the population. Allele 1 microsatellite loci 4a110 with the greatest frequency 0.650 Askin met in a population, and the lowest rate of 0.444 - in baltachevskoy. Allele 1 for total population met the average frequency 0.540, and allele 2 - with an average of 0.460. Genotypic distribution was as follows. The highest frequency of homozygotes for allele 1 was observed in the population Askin - 0,400, and the lowest - in baltachevskoy - 0.194. The highest frequency of homozygotes for allele 2 was observed in baltachevskoy population - 0,306, and the lowest - in Askin - 0,100. The highest frequency of heterozygotes observed in populations baltachevskoy and Askin - 0,500, and the lowest - in Burzyan - 0.387. The average frequency of homozygotes for allele 1 0.312, 2 allele - 0.233, heterozygotes - 0.456.
The observed distribution of alleles in the population, according to estimates, is in accordance with the equilibrium expected equilibrium Hardy-Weinberg. Calculate the rate of Fis and Fit indicate a slight process of inbreeding in this population, and outbreeding processes are not observed. Analysis locus COI-COII mtDNA confirmed prinadezhnost these bees to the subspecies Apis mellifera mellifera L. Tatyshlinskaya, Askin and baltachevskaya populations together make up the north-Bashkir population Ammellifera.
Thus, according to preliminary estimates, in the north of the Republic of Bashkortostan has preserved population Ammellifera, the gene pool is stable and isolated from the migration of genes from hybrid populations. The mechanisms of isolation can be quite different, ranging from human factors and ending with the abiotic environment factors.
  042. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Phylogenetics of honeybees Apis mellifera mellifera L. from southern and middle Urals. Materials of international conference "XLV Naukowa konferencja pszczelarska". Pulawy. 2008. P. 61.  

A.m.mellifera is very important bee subspecies in Western and Northern Eurasia. We used bees of subspecies A.m.mellifera from Bashkortostan republic and Perm region of Russia which earlier have been revealed studying polymorphism of mtDNA intergenic locus COI-COII (Ilyasov et al., 2006). Three individuals of each population were analyzed. A fragment of 632 bp in mtDNA ND2 was amplified by primers forward 5 '-TGATAAAAGAAATATTTTGA-3 ' and reverse 5 '-GAATCTAATTAATAAAAAA-3 ' (Arias, Sheppard, 1996) and sequenced in 15 bees.
Between all the bees of Urals populations 5 nucleotide substitutions were revealed where T>C replacement at position 536 in two bees DQ181614 and DQ181618 was lead to replacement in peptide aminoacid sequences in position 12 from Ile to Thr. For phylogenetic analysis we have compared sequences of mtDNA ND2 gene fragment of Ural bees with other previously published subspecies A.mellifera and constructed dendrogramm using MEGA 3.1. Sequence of subspecies A.m.anatoliaca has been used as a reference sequence. All the samples on dendrogramm are grouped into four distinct clades: A, C, M and O. Name of the clades are given according to F.Ruttner (1988), M.C.Arias, W.S.Sheppard (1996) and P.Franck et al. (2001).
Evolutionary branch M comprises samples of A.m.mellifera from Ural (DQ181611-22) and Europe: Switzerland (AY114495), France (U35758), Spain (U35759) and Norway (U35760). However two samples of subspecies A.m.sicula (AY114493-94) from Sicily and A.m.ligustica (U35752 and AY114490) from Italy belong to this clade as well what confirms hybridization with A.m.mellifera.
Thus, we can to say that between all local populations of A.m.mellifera haven’t much divergence. Maybe it consequence of historically recent divergence, significant migration between populations and absence of substantial geographical isolations in Europe.
  043. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Полиморфизм антибактериальных пептидов в популяции уральских пчел. Материалы международной научной конференции "Биоразнообразие: проблемы и перспективы сохранения". Пенза. 2008. Т.2. С. 247-248.  

Как известно, пчелы продуцируют антибактериальные пептиды для защиты от микроорганизмов. На данный момент у пчел известны антибактериальные пептиды - абецин, дефензин и гименоптецин, которые, по Б.В.Зюману (1992), являются необходимыми компонентами групповой и индивидуальной системы иммунитета пчелиной семьи. C.S.McCleskey, R.M.Melampy (1938) и H.Yamauchi (2001) продемонстрировали антибактериальные свойства маточного молочка пчел, секретируемого фарингеальными железами, которое активно против бактерий и грибков. K.Casteels-Johnson с соавт. (1994) изучали в гемолимфе у пчел, инфицированных Escherichia coli, четыре различных типа антимикробных каталитических пептидов – апидацин, гименоптецин, абецин и дефензин.
Антибактериальный пептид дефензин объединяет большое семейство цистеин-богатых каталитических антимикробных пептидов, воздействующих на разнообразные микроорганизмы, составляющих основную защитную систему большинства организмов. Дефензины пчел - пептиды длиной 36-51 аминокислот, обладающие сходством последовательности, основная структура которых состоит из концевых аминокислотных повторов, альфа-спирали и двух антипараллельных цепочек, стабилизированных 3-дисульфидными мостиками [4]. Дефензин обычно продуцируется последним из всех, но его активность продолжается свыше двух недель после инфекции [2]. Дефензин гемолимфы и его предшественник про-пептид были охарактеризованы по кДНК, выделенных из брюшной полости инфицированных пчел [3].
Другой дефензин пчел, названный роялизином, был выделен из маточного молочка пчел и был охарактеризован S.Fujiwara с соавт. (1990) на уровне пептидов. Оба дефензина пчел содержали 51 аминокислоту. Они отличались по одной аминокислоте и по группе, состоящей из двух аминокислот при сравнении последовательностей, представленных в международном GeneBank (http://www.ncbi.nlm.nih.gov). Пчелиный дефензин, также как шмелиный, был амилирован и имел дополнительное удлинение на 11 аминокислот с С-конца, что было несхоже с другими насекомыми. Оказалось, что роялизин очень активен против грамотрицательных бактерий и неэффективен против грамположительных. Также была описана антигрибковая активность пчелиного роялизина [1] и его антибактериальная активность к патогену Paenibacillus larvae, который является возбудителем болезни личинок пчел.
А.В.Львов и А.Г.Николенко (2000) обнаружили существование двух, ранее не известных, аллельных форм А и В фрагмента гена дефензина. J.Klaudiny с соавт. (2005) изучили нуклеотидную и аминокислотную последовательности гена дефензина 1 и показали, что обнаруженный ими антибактериальный пептид отличался от дефензина, описанного А.В.Львовым и А.Г.Николенко (2000), заменой T на A в положении 1471, которая приводила к аминокислотной замене Leu на His; отличался от дефензина, описанного K.Casteels-Johnson с соавт. (1994) нуклеотидными заменами GGAGT на TTAGA в положении 1507–1511, которые приводят к аминокислотной замене GlyVal на ValGly; отличался от роялизина, описанного S.Fujiwara с соавт. (1990), нуклеотидными заменами СG на TA в положении 1832–1833, которые приводят к аминокислотной замене Arg на Tyr. Кроме того, они показали, что ранее известные дефензин и роялизин были не чем иным, как полиморфными формами дефензина 1, тогда как обнаруженная ими новая последовательность гена дефензина 2 лишь на 55,8% сходна с последовательностью дефензина 1 и являлся геном новой формы дефензина. Дефензин 1 обладал уникальной среди артропод экзон-интронной структурой. Оба дефензина экспрессировались в голове и груди. Дефензин 1 обнаружен в гипофаренгиальных, мандибулярных и грудных слюнных железах пчел, тогда как дефензин 2 отсутствовал. Различная представленность этих генов отражает тканезависимую экспрессию дефензина.
Мы изучили вариабельность фрагмента гена дефензина ядерной ДНК в популяциях A.m.mellifera на Урале. В исследовании наблюдалось два аллеля этого локуса. Аллель В фрагмента гена дефензина ядерной ДНК встречался с частотой 0,14-0,25, а аллель А – с частотой 0,75-0,86. В работе А.В.Львова и А.Г.Николенко (2002) частота аллелей фрагмента гена дефензина ядерной ДНК в популяциях пчел на Урале распределялась более равномерно: аллель B встречался с частотой 0,25-0,45, а аллель A – 0,55-0,75. Для более детального сравнения можно показать, что работах А.В.Львова и А.Г.Николенко (2002) в западной и северо-восточной популяциях пчел на Урале частота встречаемости аллелей B и А фрагмента гена дефензина ядерной ДНК была 0,25 и 0,75, соответственно, в янаульской - 0,45 и 0,55, в бурзянской – 0,41 и 0,59, в иглинской – 0,32 и 0,68. В нашем исследовании в бурзянской и иглинской популяциях аллель В фрагмента гена дефензина ядерной ДНК встречался с частотой значительно меньшей таковых в работе А.В.Львова (2002). Различалось также распределение генотипов фрагмента гена дефензина ядерной ДНК в популяциях. В нашей работе генотип ВВ фрагмента гена дефензина ядерной ДНК встречался с частотой 0,06-0,11, генотип АА - 0,61-0,80, генотип АВ - 0,12-0,29, тогда как в работе А.В.Львова и А.Г.Николенко (2002) генотип ВВ встречался с частотой 0,00-0,28, генотип АА - 0,35-0,75, генотип АВ – 0,16-0,48.
Причину такого распределения аллелей и генотипов фрагмента гена дефензина ядерной ДНК на данный момент очень сложно однозначно объяснить, но можно предположить, что популяция пчел на Урале за несколько лет претерпела некоторые изменения, которые, возможно, связаны с особенностями организации и развития популяций пчел, как общественных насекомых, а также с глобальными изменениями экосистем и загрязнением окружающей среды.
As is known, bees produce antimicrobial peptides to protect against microorganisms. At the moment, the bees are known antimicrobial peptides - abetsin, defensin and gimenoptetsin which in B.V.Zyumanu (1992), are essential components of group and individual bee colony immune system. CSMcCleskey, RMMelampy (1938) and H.Yamauchi (2001) demonstrated the antibacterial properties of royal jelly bee secreted by pharyngeal glands, which is active against bacteria and fungi. K.Casteels-Johnson et al. (1994) studied in the hemolymph of bees infected with Escherichia coli, four different types of antimicrobial peptides catalyst - apidatsin, gimenoptetsin, abetsin and defensin.
Defensin antimicrobial peptides brings together a large family of cysteine-rich catalytic antimicrobial peptides that act on a variety of micro-organisms that make up the bulk of most organisms defense system. Defensins bees - 36-51 amino acid long peptides having sequence similarity, the main structure consisting of repeats terminal amino acid alpha-helices and two antiparallel chains, stabilized by 3 disulfide bridges [4]. Defensins typically produced last of all, but its activity continues for more than two weeks after infection [2]. Defensin hemolymph and its precursor pro-peptide have been characterized by cDNA isolated from abdominal cavity of infected bees [3].
Another defensin bees called royalizinom was isolated from royal jelly and bee was characterized S.Fujiwara et al. (1990) at the level of peptides. Both defensin bees contained 51 amino acids. They differ by one amino acid and the group consisting of two amino acids when comparing the sequences shown in international GeneBank (http://www.ncbi.nlm.nih.gov). Beeswax defensin, as hornet was amilirovan and had an elongation of 11 additional amino acids to the C-terminus that was dissimilar to other insects. It turned out that royalizin very active against Gram-negative bacteria and is ineffective against Gram-positive. Also described antifungal activity of bee royalizina [1] and its antibacterial activity to a pathogen Paenibacillus larvae, that is larvae bee pathogen.
A.V.Lvov and A.G.Nikolenko (2000) found the existence of two previously unknown, allelic forms A and B gene fragment of defensin. J.Klaudiny et al. (2005) examined the nucleotide and amino acid sequences defensin 1 gene and showed that they have detected an antibacterial peptide differed from defensin described A.V.Lvovym and A.G.Nikolenko (2000), by replacing T with A at position 1471, which resulted in amino acid substitution of Leu for His; different from the defensin described K.Casteels-Johnson et al. (1994) at nucleotide substitutions GGAGT TTAGA at position 1507-1511, which result in an amino acid substitution at GlyVal ValGly; different from royalizina described S.Fujiwara et al. (1990), nucleotide substitutions CG to TA at position 1832-1833, which result in amino acid substitution of Arg for Tyr. In addition, they showed that the previously known defensin and royalizin were nothing like polymorphs defensin 1, whereas they discovered a new gene sequence defensin 2 by only 55.8% similar to the sequence of defensin 1 and was a new form of defensin gene. Defensin 1 possessed unique among arthropods exon-intron structure. Both defensin expressed in the head and chest. 1 defensins found in gipofarengialnyh, mandibular and thoracic salivary glands of bees, while defensin 2 was absent. Different representations of these genes reflects tkanezavisimuyu defensin expression.
We have studied the variability of defensin gene fragments of nuclear DNA in populations Ammellifera the Urals. The study observed the two alleles of this locus. Alleles in the gene fragment of defensin nuclear DNA occurs with a frequency 0,14-0,25 and allele - with the frequency of 0,75-0,86. The paper A.V.Lvova and A.G.Nikolenko (2002), the frequency of allele gene fragment of defensin nuclear DNA in populations of bees in the Urals are more evenly distributed: B allele occurs with a frequency 0.25-0.45, and allele A - 0 , 55-0,75. For a more detailed comparison, we can show that works and A.V.Lvova A.G.Nikolenko (2002) in the western and north-eastern populations of bees in the Urals, the frequency of allele B and A gene fragment of defensin nuclear DNA was 0.25 and 0 , 75, respectively, YANAULSKY - 0.45 and 0.55, in Burzyan - 0.41 and 0.59, in Iglinsky - 0.32 and 0.68. In our study, in Burzyan and Iglinsky allele in populations defensin gene fragment nuclear DNA occurs with a frequency significantly lower than that in the A.V.Lvova (2002). Also differ in the distribution of genotypes defensin gene fragments of nuclear DNA in populations. In our work genotype BB defensin gene fragment nuclear DNA met frequency 0,06-0,11 genotype AA - 0,61-0,80 genotype AB - 0,12-0,29, whereas the AV .Lvova and A.G.Nikolenko (2002) met with BB genotype frequency of 0,00-0,28, genotype AA - 0,35-0,75, genotype AB - 0,16-0,48.
The reason for this distribution of alleles and genotypes of defensin gene fragments of nuclear DNA at the moment is very difficult to clearly explain, but it can be assumed that the population of bees in the Urals, in a few years has undergone some changes that may be associated with features of the organization and development of populations of bees, both public insects, as well as global changes of ecosystems and environmental pollution.
  044. Фахретдинова С.А., Ильясов Р.А., Поскряков А.В., Николенко А.Г. Состояние бурзянской популяции бортевых пчел Apis mellifera mellifera L. Пчеловодство. № 10. 2008 г. С. 6-7.  

Состояние бурзянской популяции бортевых пчел Apis mellifera mellifera L. (Status of the Burzyan populations of tree hollow liing bees Apis mellifera mellifera L.)
Исследования медоносной пчелы A. m. mellifera Бурзянского района проводила наша лаборатория. В частности, В.Н.Саттаровым с использованием молекулярно-генетических методов детально обследовано состояние генофонда пчел заповедника Шульган-Таш и показано, что популяция действительно существует.
Население Бурзянского района, несмотря на развитие пасечного пчеловодства, сохранило традиционное бортничество. Бортевые пчелы обитают в естественной среде в суровых условиях и проходят жесткий естественный отбор. Однако они не могут существовать абсолютно изолированно от пасек. Их популяция имеет ограниченную численность, поэтому нуждается в постоянном пополнении за счет пчел окружающих пасек. Таким образом, между ними идет постоянная миграция, которая помогает ее сохранить. Подтверждением этого факта может послужить ситуация, сложившаяся в Южноуральском заповеднике, где с исчезновением деревень полностью исчезли и бортевые пчелы, хотя сами борти сохранились. В настоящее время намечается расширение территории заповедника Шульган-Таш, что поможет сохранить биологическое и ландшафтное разнообразие широколиственных лесов, а следовательно, и среду обитания бурзянских пчел (М.Н.Косарев, 2008).
Несмотря на все меры, угроза гибридизации, а соответственно, и исчезновения этих уникальных аборигенных пчел все же остается, так как их изучение до сих пор ограничивалось в основном границами заповедника Шульган-Таш. Сохранность бортевой пчелы находится в прямой зависимости от всей популяции Бурзянского района. Поэтому необходимо исследовать пчел всего района, так как популяция подвержена сильному антропогенному
влиянию и воздействию условии окружающей среды.
Для сохранения и восстановления популяции пчел A. m. mellifera Бурзянского района в границах естественного ареала нами в дальнейшем намечен следующий объем работ: сбор биологического материала на всей территории района и прилегающих территорий; определение границ ареала бурзянской популяции A. m. mellifera; изучение генетических процессов внутри и в краевых зонах популяции; анализ генетической структуры бурзянской популяции A. m. mellifera с использованием локу- сов ядерной и митохондриальной ДНК.
Studies honeybee A. m. mellifera Burzyansky District conducted in our laboratory. In particular, V.N.Sattarovym using molecular genetic methods were examined in detail the status of the gene pool of bees Reserve Shulgan-Tash and shows that the population does exist.
Population Burzyansky area, despite the development of bee-bee preserve traditional beekeeping. Wild-hive bees live in a natural environment in harsh conditions and are subject to rigorous natural selection. However, they can not be completely isolated from the apiaries. Their population has a limited number, so need constant replenishment due to bees surrounding apiaries. Thus, there is a constant between migration, which makes it to save. Proof of this fact can serve as a situation in Yuzhnouralskaya reserve, where the disappearance of villages completely disappeared and wild-hive bee, although the board survived. At present, the planned expansion of the reserve Shulgan-Tash, which will help to conserve biological and landscape diversity of deciduous forests, and hence the habitat Burzyan bees (M.N.Kosarev, 2008).
Despite all the measures, the threat of hybridization, and accordingly, and the disappearance of these unique native bees still remains, since their study is still limited primarily to the boundaries of the reserve Shulgan-Tash. Preservation of wild-hive bee is in direct proportion to the total population Burzyansky area. Therefore it is necessary to investigate the bees the entire area, as the population is exposed to strong anthropogenic
influence and impact of environmental conditions.
To save and restore populations of bees A. m. mellifera Burzyansky area within the boundaries of natural habitat in the sequel is planned following scope of work: the collection of biological material throughout the area and surrounding areas; delimitation of the area population Burzyan A. m. mellifera; study of genetic processes within and in the boundary zones of the population; analysis of the genetic structure of populations Burzyan A. m. mellifera using loci nuclear and mitochondrial DNA.
Publication Name: Fahretdinova S.A., Ilyasov R.A., Poskryakov A.V. Nikolenko A.G. Status of the Burzyan populations of tree hollow liing bees Apis mellifera mellifera L. Russian journal of beekeeping. V. 10. 2008 P. 6-7.
  045. Ильясов Р.А., Петухов А.В., Колбина Л.М., Поскряков А.В., Николенко А.Г.Структура генофонда популяций медоносной пчелы Урала и Поволжья. Материалы международной конференции "Пчеловодство - XXI века". Москва. 2008. С.212-214.  

Одной из наиболее интересных для человека групп насекомых являются пчелы - свыше 16000 современных видов (Danforth et al., 2006), но только вид Apis mellifera L. стал широко использоваться человеком в сельскохозяйственном разведении во всем мире.
Обширный естественный ареал медоносной пчелы охватывает всю Африку, Европу и Ближний Восток. Следствием этого явилась значительная внутривидовая дифференциация (Ruttner, 1988), на данный момент общепризнано существование 25 подвидов. На территории Европы известно существование 9 подвидов A.mellifera, 8 из которых обитает в Южной и Центральной Европе. Только 1 подвид Apis mellifera mellifera L. (темная европейская, темная лесная, она же среднерусская пчела) освоил лесостепную и лесную зоны Северной Европы, что делает его очень ценным для пчеловодства в северных странах. Ещё двести лет назад этот подвид занимал в Евразии огромную территорию вдоль северной границы естественного ареала вида. Эволюция его протекала в суровых климатических условиях, в результате чего выработалась исключительная зимостойкость и устойчивость к таким заболеваниям, как нозематоз, гнилец, падевый токсикоз. В результате массового завоза пчел из южных районов в лесную и лесостепную зоны России, прежний ареал пчелы среднерусской расы оказался заселен в основном пчёлами гибридного происхождения.К сожалению, в результате непрерывного импорта пчел с юга в северные регионы произошла массовая гибридизация пчёл. В Германии массивный импорт A.m.carnica в 1840-х годах привел почти к полной замене местных пчел A.m.mellifera (Maul, Hahnle, 1994). В скандинавских странах и на Британских островах на большей части территории также вместо аборигенных пчел A.m.mellifera разводят A.m.ligustica и A.m.carnica (Cooper 1986; Dews, Milner 1991; Jensen et al., 2005). Такая же ситуация сложилась и в России.
Одним из основных условий сохранения генофонда являются методы его чёткой идентификации (Daly et al., 1991). Первоначально для этого использовался только анализ морфометрических признаков. Его основу заложил Г.А.Кожевников (1900), который сделал промеры длины хоботка пчел и предложил методику измерения их хитиновых частей. Современная морфометрическая классификация A.mellifera основывается на работах G.Goetze (1940), В.В.Алпатова (1948) и F.Ruttner et al. (1978). F.Ruttner (1988, 1992) с использованием мультивариантного анализа морфометрических признаков разработал метод отличения A.m.mellifera от других европейских подвидов, однако не смог найти четких морфометрических различий между A.m.iberica и A.m.mellifera. Н.И.Кривцов (1998) в своей работе представил стандарты размеров частей тела для подвида A.m.mellifera, используя которые можно довольно точно определить подвидовую принадлежность. Также стандарты морфометрии были получены в нашей лаборатории для подвида A.m.mellifera башкирской популяции (Саттаров, Николенко, 2002). Однако стало известно, что морфометрические методы часто не позволяют точно идентифицировать подвиды из-за сильной зависимости морфометрических характеристик пчел от условий окружающей среды и уровня внутривидовой гибридизации (Guzman-Novoa et al., 1994).
Впоследствии большинство исследователей пчел стало переходить на использование молекулярных маркеров, дающих более точные, однозначно интерпретируемые результаты по сравнению с морфометрическими методами. В нашем институте разработана методика быстрой PCR-идентификации подвида A.m.mellifera в Республике Башкортостан на основе полиморфизма межгенного локуса COI-COII мтДНК. Для определения подвидовой принадлежности популяции пчел был использован метод на основе определения полиморфизма межгенного локуса COI-COII митохондриальной ДНК, комбинация PQQ которого характеризует происхождение пчел от A.m.mellifera по материнской линии. Всего было проанализировано 69 семей пчел с 11 пасек Удмуртии, 144 семей с 11 пасек Пермского края и 406 семей 9 пасек Республики Башкортостан.
Результаты показали, что на части пасек Удмуртии преобладали семьи имеющие происхождение от A.m.mellifera. Частота пчел происходящих от A.m.mellifera была очень высокой на некоторых пасеках Камбарского, Глазовского, Можгинского, районов Удмуртии. В Мало-Пургинском, Шарканском и Завьяловском районах Удмуртии частота пчел происходящих от A.m.mellifera оказалась довольно низкой, что свидетельствует о завозе пчел южных подвидов. Найденные нами пасеки с высоким содержанием пчел происходящих от A.m.mellifera на территории Татышлинского района республики Башкортостан, возможно, являются сохранившейся частью янаульской популяции A.m.mellifera. Практически на всей территории Пермского края было обнаружено множество пасек с большинством семей, происходящих от A.m.mellifera. Эти пасеки расположены на территории Красновишерского, Нытвенского, Ординского, Частинского, Пермского, Осинского районов Пермского края. На территории Уинского района пермского края часть семей пчел имело гибридное происхождение. Возможно, что произошла некоторая степень гибридизации благодаря потоку генов извне в эти пасеки. Пчелы, обитающие на всей остальной территории, между изученными нами локальными популяциями, по ранним нашим исследованиям (Николенко, Поскряков, 2002), были интенсивно гибридизованы с завозными южными подвидами.
Таким образом, обнаруженные нами пасеки с высокой частотой встречаемости семьей пчел, имеющих происхождение от A.m.mellifera, позволяют говорить о сохранении на Урале локальных популяций темной лесной или среднерусской пчелы. Генетическая структура популяций пчел на Урале и Поволжье очень сложная, прерывистая и фрагментированная. Нет большого непрерывного массива генофонда пчел, происходящих от темной лесной пчелы, а островная модель популяции, описанная в 1969 году С. Райтом, оказалась для них очень подходящей. Между локальными популяциями происходит непрерывный поток генов как под воздействием антропогенных, так и естественных внутрипопуляционных факторов. Благодаря некоторой степени изоляции между ними происходит процесс дивергенции, что приводит к накоплению в популяции пчел происходящих от A.m.mellifera генетического разнообразия и тем самым повышает его устойчивость к факторам окружающей среды. Для сохранения популяции пчел, происходящих от A.m.mellifera, на Урале и Поволжье необходимо сохранить генофонд каждой из обнаруженных нами локальных популяций в чистоте и определенной изоляции от потока генов из популяций пчел гибридного происхождения.
One of the most interesting groups of insects are human bees - more than 16,000 modern species (Danforth et al., 2006), but just kind of Apis mellifera L. was widely used by man in the agricultural cultivation worldwide.
Extensive natural range honeybee covers the whole of Africa, Europe and the Middle East. The result was significant intraspecific differentiation (Ruttner, 1988), at the moment it is generally accepted the existence of 25 subtypes. In Europe it is known the existence of 9 subspecies A.mellifera, 8 of which lives in South and Central Europe. Only 1 subspecies Apis mellifera mellifera L. (European dark, dark forest, she Central Russian bee) has mastered steppe and forest zones of Northern Europe, which makes it very valuable for beekeeping in the Nordic countries. More hundred years ago, this subspecies is served in the vast territory of Eurasia along the northern border of the natural range of the species. The evolution of his flowed in severe climatic conditions, resulting in a developed an exceptional winter hardiness and resistance to diseases such as nosema, foulbrood, honeydew toxicosis. As a result, the mass importation of bees from southern areas in the forest and steppe zones of Russia, the former area of ​​the Central Russian bee races were inhabited mostly by bees hybrid proiskhozhdeniya.K Unfortunately, as a result of continuous import of bees from the south to the northern regions there was a mass of bees hybridization. In Germany, a massive import Amcarnica in the 1840s has led to almost complete replacement of native bees Ammellifera (Maul, Hahnle, 1994). In the Nordic countries and the British Isles in most of the well instead of native bees bred Ammellifera Amligustica and Amcarnica (Cooper 1986; Dews, Milner 1991; Jensen et al., 2005). A similar situation exists in Russia.
One of the main conditions for the preservation of the gene pool are methods of identifying a clear (Daly et al., 1991). Initially it was used only the analysis of morphometric characters. He laid the foundation G.A.Kozhevnikov (1900), who made measurements of the proboscis bees and proposed a method of measuring their chitin parts. Modern morphometric classification is based on the works of A.mellifera G.Goetze (1940), V.V.Alpatova (1948) and F.Ruttner et al. (1978). F.Ruttner (1988, 1992) using multivariate analysis of morphometric characters developed a method for distinguishing Ammellifera other European subspecies, but could not find a clear distinction between morphometric and Amiberica Ammellifera. N.I.Krivtsov (1998) in their work introduced standards for the size of body parts subspecies Ammellifera, using which you can quite accurately determine the subspecies. Also standard morphometry were obtained in our laboratory for the subspecies Ammellifera Bashkir population (Sattar, Nikolenko, 2002). However, it became known that the morphometric methods often do not accurately identify the subspecies of the strong dependence of morphometric characteristics of bees on the environment and the level of intraspecific hybridization (Guzman-Novoa et al., 1994).
Subsequently, most of the researchers was the bees to pass on the use of molecular markers, which give a more accurate, clearly interpretable results compared with morphometric methods. In our institute developed a method of rapid PCR-identification of subspecies Ammellifera in Bashkortostan-based polymorphism intergenic locus COI-COII mtDNA. To determine the subspecies bee population has been used a method based on the definition of polymorphism of the intergenic locus COI-COII mitochondrial DNA, which is characterized by a combination of PQQ origin of bees from Ammellifera maternal. There were analyzed 69 bee colonies from 11 apiaries Udmurtia, 144 families from 11 apiaries Perm region and 406 families 9 apiaries in the Republic of Bashkortostan.
The results showed that of the apiaries Udmurtia dominated family originating from Ammellifera. The frequency of bees originating from Ammellifera was very high in some apiaries Kambarka, Glazov, Mozhginsky, Udmurtia regions. The Little Purginskom, Sharkan and Udmurtia regions Zavyalovsky frequency of bees originating from Ammellifera was quite low, indicating that the importation of bees southern subspecies. We found high in the apiary bees Ammellifera originating from the territory of the Republic of Bashkortostan Tatyshlinskogo district are arguably preserved part of the population YANAULSKY Ammellifera. Almost the entire territory of Perm Krai was found many apiaries with most families originating from Ammellifera. These apiaries are located in Krasnovishersky, Nytvensky, Orda, Chastinskogo, Perm, Perm Krai Osa region. On the territory of Perm Krai Uinskogo area of ​​the bee colonies had a hybrid origin. It is possible that there was some degree of hybridization due to gene flow from the outside in the apiary. Bees living on the rest of the territory between the studied local populations, according to our earlier studies (Nikolenko, Poskryakov, 2002), have been extensively hybridized to imported from the southern subspecies.
Thus, we found an apiary with a high frequency of occurrence of bee family, originating from Ammellifera, allow to speak about the preservation of local populations in the Urals and Central Russia dark forest bees. The genetic structure of populations of bees in the Urals and the Volga region is very complicated, fragmented and discontinuous. There is a large array of continuous gene pool of bees originating from a dark forest bees and island population model described in 1969 by C. Wright, it was very suitable for them. Between local populations is a continuous gene flow under the impact of anthropogenic and natural factors intrapopulation. Due to some degree of isolation between the process of divergence, leading to the accumulation in the bee population originating from Ammellifera genetic diversity and thus increases its resistance to environmental factors. To save the bee population originating from Ammellifera, the Urals and the Volga region need to preserve the gene pool of each of the local populations we found clean and a certain isolation from the flow of genes from the bee populations of hybrid origin.
  046. Ильясов Р.А., Комиссар А.Д., Поскряков А.В., Николенко А.Г. Украинские пчелы - уникальный подвид или экотип македонских пчел? Пчеловодство. № 1. 2008. С. 10-11

Украинские пчелы - уникальный подвид или экотип македонских пчел? (Ukrainian bees - are unique subspecies or ecotype Macedonian bees? Russian journal of beekeeping)
Образцы пчел A. m. ligustica из Италии разделились на две группы, одна из которых была близка к группе A. m. macedonica, а другая находилась на значительном отдалении от A. m. macedonica и А. т. carnica и была близка к А. т. mellifera. Согласно результатам исследований морфометрических характеристик пчелы из Италии обладали большим сходством с A. m. carnica из Австрии и Югославии (Ruttner, 1988). Возможно, некоторые популяции A. m. ligustica из Италии пересекались с пчелами A. m. mellifera из Франции, что подтверждает полиморфизм межгенно- го локуса COI-COII мтДНК (Franck et al., 2000).
Исходя из сравнительного анализа нуклеотидных последовательностей фрагмента гена ND2 мтДНК можно считать, что исследованные образцы украинских пчел относятся к подвиду A. m. macedonica, и исключить предположения о том, что они — южная ветвь среднерусских пчел A. m. mellifera. Вероятно, краинские A. m. carnica и македонские А. т. macedonica пчелы по отношению друг к другу являются подвидами, а не экотипами, что противоречит гипотезе В.Губина (1977) о том, что украинские пчелы могут быть одной из популяций A. m. carnica. Полученные данные — еще одно подтверждение гипотезы Ф.Руттнера (1988) о возможной принадлежности украинских пчел к македонским A. m. macedonica, то есть мы имеем украинскую локальную популяцию A. m. macedonica с возможным названием Apis mellifera macedonica var. ukrainica (предложение А.Д.Комиссара, 2005).
Samples bees A. m. ligustica from Italy were divided into two groups, one of which was close to the group A. m. macedonica, while others are at a considerable distance from A. m. macedonica and A. m. carnica and was close to A. m. mellifera. According to the research of morphometric characteristics of bees from Italy have much in common with A. m. carnica from Austria and Yugoslavia (Ruttner, 1988). Perhaps some populations of A. m. ligustica from Italy crossed with bees A. m. mellifera from France, which confirms mezhgenno- polymorphism locus of mtDNA COI-COII (Franck et al., 2000).
Based on the comparative analysis of the nucleotide sequences of mtDNA ND2 gene fragment can be assumed that the samples studied Ukrainian bees belong to the subspecies A. m. macedonica, and exclude the assumption that they - the southern branch of the Central Russian bees A. m. mellifera. Probably Krajina A. m. carnica and Macedonian A. m. macedonica bees in relation to each other is a subspecies, not ecotypes, which contradicts the hypothesis V.Gubina (1977) that the Ukrainian bees can be one of the populations of A. m. carnica. The obtained data - yet another confirmation of the hypothesis of F.Ruttner (1988) about a possible accessory to the Macedonian Ukrainian bees A. m. macedonica, that is, we have a local Ukrainian population of A. m. macedonica with possible name Apis mellifera macedonica var. ukrainica (offer A.D.Komissar, 2005).
Publication Name: Ilyasov R.A., Commissar A.D., Poskryakov A.V. Nikolenko A.G. Ukrainian bees - are unique subspecies or ecotype Macedonian bees? Russian journal of beekeeping. V. 1. 2008. P. 10-11.
  047. Ильясов Р.А., Шареева З.В., Кутлин Н.Г., Поскряков А.В., Николенко А.Г. Генетический полиморфизм в популяциях пчел Урала и Поволжья. Материалы международной научно-практической конференции "Биологические науки в XXI веке". Бирск. 2008. С. 23-27.  

Первоначальные исследования генофонда пчел с использованием метода RFLP (полиморфизма длин рестрикционных фрагментов) проводились на тотальной митохондриальной ДНК (мтДНК). D.R.Smith, W.M.Brown (1988) показали генетические различия подвида A.m.mellifera от африканизированных пчел в США методом RFLP мтДНК эндонуклеазами BcII, EcoRI, NdeI, XbaI.
Открытие PCR (полимеразной цепной реакции) в 80-х годах (Mullis et al., 1994) сделало возможным изучение полиморфизма ДНК и привело к революции в области молекулярной биологии. В результате для изучения полиморфизма в популяциях пчел стали использовать модифицированный вариант RFLP, где происходит рестрикция амплифицированных фрагментов ДНК. H.G.Hall, D.R.Smith (1991) на основе RFLP анализа амплифицированных фрагментов генов CO-I и CO-II эндонуклеазами EcoRI, HincII, Xba I показали уровень генетической вариабельности популяции пчел Испании. На основе RFLP анализа амплифицированногго фрагмента межгенного локуса COI-COII мтДНК с использованием эндонуклеазы DraI была изучена генетическая структура популяции пчел Франции (Franck et al., 1998), Италии (Franck et al., 2000), Норвегии, Швеции, Дании, Шотландии, Англии, Ирландии (Jensen et al., 2005).
Параллельно с методом модифицированной RFLP в изучении генома пчел развивался метод RAPD (полиморфизм длин амплифицированных фрагментов со случайно выбранными праймерами). Метод RAPD нашел применение в исследованиях генома медоносной пчелы (Чудинов, 1999). С использованием метода RAPD G.J.Hunt и R.E.Page (1995) составили 26 групп сцепления и картировали гены определения пола, цвета тела и малат дегидрогеназы пчел.
Помимо метода RAPD в популяционных исследованиях пчел использовалась аллель-специфичная PCR. В нашем институте был разработан метод идентификации подвида A.m.mellifera на Урале в Республике Башкортостан на основе электрофоретического разделения в агарозном геле амплифицированных локусов межгенного локуса COI-COII мтДНК. Наша лаборатория также проводила поиск популяций подвида A.m.mellifera  на Южном и Среднем Урале на территории республики Башкортостан и Пермского края с ипользованием полиморфизма межгенного локуса COI-COII мтДНК (Сатаров, Николенко, 2000; Николенко, Поскряков, 2002) в результате чего были выделены сохранившиеся популяции A.m.mellifera  (Ильясов, 2005; Ильясов с соавт., 2006, 2007, 2008).
Методика изучения генетического полиморфизма популяций пчел на основе полиморфизма SSR (микросателлитных локусов) основана также на аллель-специфичной PCR. В последнее время полиморфизм микросателлитных локусов широко используется во всем мире в изучении генетической структуры и уровня вариабельности популяций пчел разными исследователями. Так A.Estoup et al. (1995) изучал эти вопросы на основе полиморфизма 7 микросателлитных локусов (B124, A7, A24, A113, A28, A88, A43), а P.Franck et al. (1998, 2000) на основе оценки полиморфизма 8 микросателлитных локусов в разных странах Европы, P.De La Rua et al. (2002) - на основе оценки полиморфизма 8 микросателлитных локусов в Северо-Восточной Италии, A.Jensen et al. (2005) - 11 микросателлитных локусов в Норвегии, Швеции, Дании, Шотландии, Англии, Ирландии. В нашей лаборатории Р.А.Ильясов (2006) и Ильясов с соавт., 2006, 2007, 2008 на основе полиморфизма 2 микросателлитных локусов (Ap243, 4a110) изучили генетическую вариабельность популяций пчел на Южном и Среднем Урале на территории Республики Башкортостан и Пермского края.
Секвенирование ДНК также является часто используемым методом в популяционно-генетических исследованиях пчел. J.-M.Cornuet et al. (1991) просеквенировали межгенный локус COI-COII мтДНК пчел и показали различия A.m.mellifera от других подвидов. После изобретения автоматического секвенатора стало доступным секвенирование большого количества образцов за сравнительно короткое время. M.C.Arias, W.S.Sheppard (1996) на основе секвенирования фрагмента гена ND2 мтДНК показали различия A.m.mellifera от других подвидов пчел в Европе. В нашей лаборатории Р.А.Ильясов с соавт. (2006) на основе секвенирования фрагмента гена ND2 мтДНК показали различия A.m.mellifera от южных подвидов пчел на Урале на территории республики Башкортостан. Совсем недавно сотрудники консорциума по секвенированию генома пчелы просеквенировали весь геном медоносной пчелы и показали различия между A.m.mellifera и другими подвидами (Weinstock et al., 2006). Было показано, что подвид A.m.iberica очень сходен с A.m.mellifera и при кластерном анализе группируются вместе.
Самым новым и многообещающим методом генетической анализа пчел является изучение полиморфизма SNP (однонуклеотидного полиморфизма), на основе чего можно будет составить генетический паспорт пчелы, очень быстро и дешево определить подвидовую принадлежность пчел и филогенетический паттерн. На сегодняшний день для медоносной пчелы известно несколько тысяч SNP (Whitfield et al., 2006).
Изучение генетической вариабельности в популяции пчел Урала и Поволжья было выполнено с использованием порядка 10 генетических маркеров. Оказалось, что пчелы не по всем маркерам обладают значительным полиморфизмом. Так микросателлитный локус ap049 в популяции пчел Башкортостана обладал очень незначительным полиморфизмом и в дальнейшем не был использован. Также отсутствовал полиморфизм длины у генов ND2 мтДНК, COI мтДНК и интрона гена EF1-α ядерной ДНК – у них наблюдается SNP полиморфизм, который выявляется только секвенированием. Полиморфизм этих генов также частично выявляется рестрикцией эндонуклеазой DraI. Значительным полиморфизмом обладали все остальные микросателлитные локусы – ap243, 4a110, A8, A113 ядерной ДНК. Очень интересный полиморфизм наблюдался у межгенного локуса COI-COII мтДНК, где мы обнаружили существование 4 гаплотипов (Q, PQ, PQQ и PQQQ). Кроме того, в популяции пчел Урала и Поволжья полиморфным является ген антибактериального пептида дефензина (Львов, 2002). Оказалось, что для большинства популяций пчел, где не происходит массовый ввоз семей, наблюдается некоторая доля инбридинга, тогда как в популяциях, в которые завозят пчел извне, наблюдается аутбридинг. По результатам исследований было опубликовано ряд работ в журналах «Пчеловодство» и «Генетика».
Лаборатория биохимии адаптивности насекомых Института биохимии и генетики Уфимского НЦ РАН заинтересована в расширении ареала исследований и числа анализируемых локусов пчел, а также в сотрудничестве с крупными и частными пчеловодными хозяйствами. По результатам тестов мы можем предоставить данные о генетической структуре, подвидовом составе, направлении генетических процессов и ходе эволюционных преобразований исследуемых пасек.
Initial studies of the gene pool of bees using the method of RFLP (restriction fragment length polymorphism) were carried out on a total of mitochondrial DNA (mtDNA). DRSmith, WMBrown (1988) have shown genetic differences Ammellifera subspecies of Africanized honey bees in the United States by mtDNA RFLP endonucleases BcII, EcoRI, NdeI, XbaI.
Opening of PCR (polymerase chain reaction) in 80 years (Mullis et al., 1994) has made it possible to study DNA polymorphism and led to a revolution in the field of molecular biology. As a result of studying polymorphism in bee populations started using a modified version of RFLP, where the restriction of the amplified DNA fragments. HGHall, DRSmith (1991) based on RFLP analysis of the amplified gene fragments CO-I and CO-II endonuclease EcoRI, HincII, Xba I showed a level of genetic variability bee population Spain. On the basis of RFLP fragment analysis amplifitsirovannoggo intergenic locus COI-COII mtDNA with endonuclease DraI was studied genetic structure of the population of bees in France (Franck et al., 1998), Italy (Franck et al., 2000), Norway, Sweden, Denmark, Scotland, England, Ireland (Jensen et al., 2005).
In parallel with the modified RFLP method in studying the genome of bees developed technique RAPD (amplified fragment length polymorphism with randomly selected primers). RAPD method has been applied in the study of the genome of the honey bee (Chudinov, 1999). Using the method of RAPD GJHunt and REPage (1995) amounted to 26 linkage groups and mapped the genes of sex determination, the color of the body and malate dehydrogenase bees.
In addition to the RAPD method in population studies of bees used allele-specific PCR. Our institute has been developed a method of identifying subspecies Ammellifera the Urals in the Republic of Bashkortostan on the basis of electrophoretic separation in an agarose gel of amplified loci intergenic locus COI-COII mtDNA. Our laboratory also conducted search Ammellifera subspecies populations in the South and Middle Urals, on the territory of the Republic of Bashkortostan and the Perm edge programs included with polymorphism intergenic locus COI-COII mtDNA (Satarov, Nikolenko, 2000; Nikolenko, Poskryakov, 2002) resulting in the marked surviving populations Ammellifera (Ilyasov, 2005; Ilyasov et al., 2006, 2007, 2008).
Method for studying the genetic polymorphism of bee populations on the basis of polymorphism SSR (microsatellite loci) is also based on allele-specific PCR. Recently, a polymorphism of microsatellite loci are widely used around the world in the study of the genetic structure and the level of variability of bee populations by different researchers. Thus A.Estoup et al. (1995) studied these questions on the basis of polymorphism of 7 microsatellite loci (B124, A7, A24, A113, A28, A88, A43), and P.Franck et al. (1998, 2000) based on an assessment of polymorphism 8 microsatellite loci in different European countries, P.De La Rua et al. (2002) - based on the assessment of polymorphism 8 microsatellite loci in the North-East of Italy, A.Jensen et al. (2005) - 11 microsatellite loci in Norway, Sweden, Denmark, Scotland, England, Ireland. In our laboratory R.A.Ilyasov (2006) and Ilyasov et al., 2006, 2007, 2008, based on microsatellite loci polymorphism 2 (Ap243, 4a110) studied the genetic variability of bee populations in the South and Middle Urals, on the territory of the Republic of Bashkortostan and the Perm edge .
DNA sequencing was also a frequently used method in population genetic studies of bees. J.-M.Cornuet et al. (1991) sequenced intergenic locus COI-COII mtDNA bees and showed differences Ammellifera from other subspecies. After the invention of the automatic sequencer made available sequencing of a large number of samples in a relatively short time. MCArias, WSSheppard (1996) on the basis of the gene sequencing fragment ND2 Ammellifera mtDNA showed no difference from other subspecies of bees in Europe. In our laboratory R.A.Ilyasov et al. (2006) based on the sequencing of the gene fragment ND2 mtDNA showed differences Ammellifera from the southern subspecies of bees on the territory of the Urals republic of Bashkortostan. Most recently, the staff of the consortium for sequencing the genome sequenced the entire genome of bee honey bee and showed differences between Ammellifera and other subspecies (Weinstock et al., 2006). It was shown that subtype Amiberica very similar to Ammellifera and cluster analysis are grouped together.
The most novel and promising method of genetic analysis is the study of bees polymorphism SNP (single nucleotide polymorphism), based on which it will be possible to make genetic passport bees very quickly and cheaply identify subspecies of bees and phylogenetic pattern. Today, for the honeybee are several thousand SNP (Whitfield et al., 2006).
The study of genetic variation in the population of bees of the Urals and the Volga region was performed using about 10 genetic markers. It was found that the bees do not all have significant polymorphism markers. So ap049 microsatellite loci in the population of bees Bashkortostan had very little polymorphism in the future has not been used. Also absent length polymorphism in mtDNA genes ND2, COI mtDNA and intron of EF1-α nuclear DNA - they observed SNP polymorphism, which is detected only by sequencing. Polymorphisms of these genes are also partly revealed by restriction endonuclease DraI. Significant polymorphism had all the other microsatellite loci - ap243, 4a110, A8, A113 nuclear DNA. Very interesting polymorphism observed in intergenic locus COI-COII mtDNA, where we discovered the existence of four haplotypes (Q, PQ, PQQ and PQQQ). In addition, the bee population of the Urals and the Volga is a polymorphic gene defensin antimicrobial peptides (Lviv, 2002). It was found that for the majority of bee populations, where there is no mass import of families there is some percentage of inbreeding, while the populations in which the bees are imported from outside, there is outbreeding. According to the research it published a number of papers in the journals "Beekeeping" and "Genetics".
Laboratory of Biochemistry adaptability insects Institute of Biochemistry and Genetics, Ufa Scientific Center, Russian Academy of Sciences is interested in expanding the area of ​​research and the number of loci analyzed bees, and in collaboration with major private and beekeeping farms. According to the results of tests we can provide information on genetic structure, subspecies composition, direction and progress of the genetic processes of evolutionary transformations studied apiaries.
  048. Ильясов Р.А., Шареева З.В., Кутлин Н.Г., Поскряков А.В., Николенко А.Г. Пчеловодство северных районов республики Башкортостан. Материалы международной научно-практической конференции "Биологические науки в XXI веке". Бирск. 2008. С. 190-194.  

Анализируя состояние генофонда среднерусских пчел, Кривцов Н.И. (2005) считает, что основания для тревоги есть, но положение не столь драматично. В Западной Европе вытеснение темной лесной пчелы началось еще раньше (около 150 лет назад) и шло интенсивнее, чем в России, тем не менее, в некоторых странах Западной Европы еще сохранились популяции темной европейской пчелы Apis mellifera mellifera. Для улучшения сложившейся ситуации, по мнению Кривцова Н.И., необходимо поставить вопрос о создании совета по пчеле среднерусской расы в рамках селекционно-информационного центра при НИИ пчеловодства.
Вопрос о сохранении аборигенной пчелы в первую очередь связан с ее преимуществами перед гибридными. Среднерусские пчелы обладают более высокой зимостойкостью, меньше реагируют на резкие колебания температуры. Весеннее развитие пчелиных семей начинается немного позже, а затем ее интенсивность быстро нарастает. По медопродуктивно-сти среднерусские пчелы в условиях бурного медосбора с липы, гречихи, вереска и других медоносов превосходят гибридных, испытываемых в этих условиях. Они обладают хорошей воскопродуктивностью и способностью приносить много пыльцы.
По данным Р.А.Ильясова с соавт. (2006) на Урале сохранились резерваты Apis mellifera mellifera L. в Бурзянском и Татышлинском районах Республики Башкортостан и Пермском крае. Мы решили продолжить поиск сохранившихся локальных популяций и задались целью исследовать для начала три северных района Республики Башкортостан: Бирский, Мишкинский и Караидельский. Интересен тот факт, что по результатам Саттарова В.Н. (2000) в Бирском районе в СПК «Ленина» более 50% пчел являлись гибридными.
Бирский, Мишкинский и Караидельский районы относятся к лесостеп-ной зоне северной подзоне Республики Башкортостан. Данная местность имеет облесенность от 25 до 70%, массивы которой представлены елово-пихтово-сосновым древостоем с примесью широколиственных: липы, березы, осины. Период медосбора недолгий, главный - приходится на июль. Безоблетное время длится до шести месяцев. Многие пчеловоды предпочитают зимовку на улице. В подобных условиях гибридным пчелам выжить нелегко (Власов, 1983).
По словам начальника Бирского межрайонного объединения (МРО) пчеловодства Н.М.Фаттахова (2008) пчеловодство в наших районах насчи-тывает многолетнюю историю. Люди занимались пчеловодством еще до ре-волюции, в том числе и во всех существующих монастырях. В период коллективизации многие пасеки были объединены в крупные колхозные. Для их обслуживания в северной зоне в 1948 году было организовано Бирское МРО пчеловодства. Позже были организованы Мишкинское и Караидельское МРО. Общее руководство пчеловодством осуществляла Башпчелоконтора при МСХ БАССР. Всего по Башкирии было 4 МРО: Уфимское, Стерлитамакское, Бирское и Туймазинское. Каждое из них обслуживало 14 районов.
В 1960-1970гг. был массовый завоз серых горных кавказских пчел в северные районы Республики Башкортостан для опытных целей, что позднее было запрещено. В эти годы пчеловодству уделялось большое внимание со стороны правительства. Было организовано производство ульев, построен воскоперерабатывающий завод. Каждую зиму с пчеловодами хозяйств проводилась учеба по повышению квалификации, для чего была создана школа пчеловодства, работала Башкирская опытная станция пчеловодства.
По данным Власова В.Н. (1983) в 1970-80гг. была налажена хорошая работа на матковыводных пасеках (1,5-2 тыс. маток) Мишкинского района. На пасеках Караидельского района проводилось испытание и использование дочерей от рекордисток и это показало, что такая селекция способствует улучшению полезных признаков местных пчел и обеспечивает устойчивую медопродуктивность рядовых пасек в последующие годы. От уровня племен-ной работы зависели качество семей и товарность пасек, увеличение производства высококачественного башкирского целебного меда.
Во времена перестройки многие колхозные пасеки были распроданы, зоотехнические службы – расформированы. Появились новые заготовители. МРО утратило свои позиции за отсутствием оборотных средств. С конца 2006 года каждый район работает самостоятельно. По мнению Фаттахова Н. М., настоящее время – время частного пчеловодства, что снижает возмож-ность контроля свыше, но не мешает анализировать их состояние.
Для исследований были отобраны пчелы с 42 пасек трех районов, не менее чем из 25% пчелосемей с пасеки. С каждой семьи брали по 5 рабочих особей, которых фиксировали в 96% этаноле и хранили в морозильной камере. ДНК выделяли из летательных мышц пчел по методу смесью гуанидинтиоционат-фенол-хлороформ (Chomezynski, Sacchi, 1987).
В анализе популяций в качестве генетического маркера использовали межгенный локус COI-COII мтДНК, полиморфизм которого был установлен ранее у представителей разных подвидов Apis mellifera (Cornuet et al., 1991). А.Г.Николенко и А.В.Поскряков (1998) ранее использовали этот полиморфизм в качестве маркера для различения подвидов A.m.mellifera и A.m.caucasica (Ильясов Р.А., 2006). Этот маркер был использован нами для поиска популяций A.m.mellifera.
Полимеразную цепную реакцию (ПЦР) проводили в термоциклере «Циклотерм» при оптимальном для каждого локуса температурном режиме. Выделенную ДНК проверяли на качество в агарозном геле и а продукты ПЦР электрофоретически фракционировали в полиакриламидном геле, после чего окрашивали бромистым этидием и фотографировали в трансиллюминаторе.
По исследуемым нами районам (Бирский, Мишкинский, Караидель-ский) анализ полиморфного межгенного локуса COI-COII мтДНК показал, что частота комбинации PQQ, характеризующего пчелу среднерусской расы, более 90%. Полученные нами данные позволяют говорить о сохранении среднерусских пчел в данных районах, куда ранее были завезены пчелы других подвидов из южных регионов России. Это позволяет предположить возможность восстановления аборигенного генофонда под воздействием факторов окружающей среды, куда можно включить и антропогенные факторы.
В настоящее время нами проводятся сравнительные популяционно-генетические исследования выделенных популяций с изучением полимор-физма микросателлитных локусов ядерного генома, так как митохондриаль-ная ДНК позволяет судить лишь о материнской наследственности.
Analyzing the gene pool of the Central Russian bees NI Krivtsov (2005) believes that there is cause for concern, but the situation is not so dramatic. In Western Europe, the displacement of the dark forest bees started even earlier (about 150 years ago) and went harder than in Russia, however, in some countries of Western Europe are still preserved populations dark European bee Apis mellifera mellifera. To improve the situation, according to NI Krivtsov, you must raise the question of the establishment of the Board of the Central Russian bee races in the framework of breeding and information center at the Institute of beekeeping.
The issue of preservation of native bees in the first place associated with its advantages over hybrid. Central Russian bees have higher winter hardiness, less responsive to rapid changes in temperature. The spring development of bee colonies begins a little later, and then its intensity rapidly increases. By Medoproduktivnost-sti Central Russian bees in terms of rapid medosbora with lime, buckwheat, heather honey plants and other superior hybrid tested in these conditions. They have a good voskoproduktivnostyu and the ability to bring a lot of pollen.
According R.A.Ilyasova et al. (2006) Urals preserved reserves Apis mellifera mellifera L. in Burzyan and Tatyshlinskom areas of the Republic of Bashkortostan and the Perm region. We decided to continue the search for the remaining local populations and set out to explore to begin the three northern region of the Republic of Bashkortostan: Birsky, Mishkinskoye and Karaidelsky. An interesting fact is that the results Sattarova VN (2000) Birsk area in the SEC "Lenin" over 50% of the bees is a hybrid.
Birsky, Mishkinskoye and Karaidelsky areas are forest-steppe zone of the North-term sub-zone of the Republic of Bashkortostan. The area has a forest cover of 25 to 70%, which shows arrays spruce-fir-pine stands with an admixture of deciduous: linden, birch, aspen. Medosbora short period, the main - is in July. Bezobletnoe time lasts up to six months. Many beekeepers prefer to winter in the street. In such circumstances the hybrid bees to survive is not easy (Vlasov, 1983).
According to the head of interdistrict Birsk Association (MPO) Beekeeping N.M.Fattahova (2008) Beekeeping in our neighborhoods naschi Pipeline long history. People engaged in beekeeping before re-revolution, including all existing monasteries. During the period of collectivization, many apiaries were merged into large collective farms. For their service in the northern zone in 1948 it was organized by the MPO Birsk beekeeping. Later they were organized and Mishkinskoye Karaidelskoe MPO. The general management of beekeeping in the Ministry of Agriculture carried out Bashpchelokontora BASSR. Total Bashkiria was 4 MPO: Ufa, Sterlitamak, and Birsk Tuymazinskoe. Each of them served 14 districts.
In 1960-1970gg. It was a massive importation of gray mountain Caucasian bees in the northern areas of the Republic of Bashkortostan for power purposes, which was later banned. During these years, beekeeping has received considerable attention from the government. It organized the production of beehives built voskopererabatyvayuschy plant. Every winter, beekeepers households conducted studies on professional development, which has created a school of beekeeping, worked Bashkir beekeeping Experiment Station.
According to Vlasov, VN (1983) in 1970-80gg. was arranged a good job on matkovyvodnyh apiaries (1,5-2 thousand. queens) Mishkinsky area. On apiaries Karaidelskogo District conducted testing and use of the daughters of rekordistok and it showed that this helps to improve the selection of useful traits of local bees and provides a stable medoproduktivnost ordinary apiary in the following years. From the level of tribes-term quality of the work depended families and marketability of apiaries, increasing the production of high-quality curative Bashkir honey.
During perestroika, many kolkhoz apiary were sold, livestock Service - disbanded. There are new collectors. MPO has lost its position in the absence of working capital. Since late 2006, each district operates independently. According Fattakhova NM, is now - time private beekeeping, which reduces the possibility of control over, but does not prevent analyze their condition.
For the study were selected from 42 apiaries bee three areas of at least 25% of bee colonies from the apiary. Each family took 5 working specimens which were fixed in 96% ethanol and stored in a freezer. DNA was isolated from muscle flying bee method guanidintiotsionat mixture phenol-chloroform (Chomezynski, Sacchi, 1987).
In the analysis of the population as a genetic marker used intergenic locus COI-COII mtDNA polymorphisms which was previously set at representatives of different subspecies of Apis mellifera (Cornuet et al., 1991). A.G.Nikolenko and A.V.Poskryakov (1998) have previously used this polymorphism as a marker to distinguish between subspecies and Ammellifera Amcaucasica (Ilyasov RA 2006). This marker was used to search for our populations Ammellifera.
Polymerase chain reaction (PCR) was performed in a thermal cycler "Tsikloterm" at the optimum temperature for each locus mode. The isolated DNA was checked on quality agarose gel and PCR products were fractionated electrophoretically in a polyacrylamide gel, then stained with ethidium bromide and photographed in transilluminator.
In the studied areas (Birsky, Mishkinskoye, Karaidel-sky) an analysis of polymorphic intergenic locus COI-COII mtDNA showed that the frequency combination of PQQ, which characterizes Central Russian bee race, more than 90%. Our data suggest the Central Russian bees in maintaining these areas, where the bees were brought before other subspecies of the southern regions of Russia. This suggests the possibility of restoring the indigenous gene pool under the influence of environmental factors, which can be switched on and anthropogenic factors.
Currently, we carry out a comparative population genetic studies dedicated to the study of population polymorphism-phism microsatellite loci of the nuclear genome, as mitochondrial DNA Nye gives an indication only of maternal inheritance.
  049. Ильясов Р.А., Шареева З.В., Поскряков А.В., Кутлин Н.Г., Николенко А.Г. Изучение генетической вариабельности в популяции пчел Урала и Поволжья. Материалы международной научно-практической конференции "Инновации в пчеловодстве. Технологии, инвентарь, продукция". Сочи. 2009. С. 136-140.  

Одним из основных условий успешного пчеловодства является знание о генетической структуре и уровне вариабельности популяции пчел. Условиями стабильности популяции являются равновесие Харди-Вайнберга, отсутствие потока генов между популяциям и оптимальный уровень генетической вариабельности. Стабильность популяции пчел постоянно нарушается под воздействием антропогенных факторов. Данные о структуре генофонда могут дать популяционные исследования.
Первоначально в популяционных исследованиях использовался только анализ морфометрических признаков. Его основу заложил Г.А.Кожевников (1900), который сделал промеры длины хоботка пчел и предложил методику измерения их хитиновых частей. Современная морфометрическая классификация A.mellifera основывается на работах G.Goetze (1940), В.В.Алпатова (1948) и F.Ruttner et al. (1978). Также стандарты морфометрии были получены в нашей лаборатории для подвида A.m.mellifera башкирской популяции (Саттаров, Николенко, 2002). Однако выяснилось, что морфометрические методы часто не позволяли точно идентифицировать подвиды из-за сильной зависимости морфометрических характеристик пчел от условий окружающей среды и уровня внутривидовой гибридизации (Guzman-Novoa et al., 1994; Симанков, 1999; Roubik et al., 2001).
Впоследствии большинство исследователей пчел стало переходить на использование молекулярных маркеров (Arias, Sheppard, 1996), дающих более точные, однозначно интерпретируемые результаты по сравнению с морфометрическими методами. Изучение различий в частотах аллелей энзимов, которое вызвано генетическими изменениями, в конце 60-х годов легло в основу метода изучения популяций пчел с использованием аллозимного полиморфизма (Richardson et al., 1986, Behura, 2006). Для гаплодиплоидных Heminoptera сначала предсказывали высокий уровень полиморфизма аллозимов (Mestriner, 1969; Crozier, 1973; Tomaszewski et al., 1973; Contel et al., 1977). Однако у медоносной пчелы A.mellifera был отмечен очень низкий уровень аллозимного полиморфизма, где из 23 ферментов полиморфными оказались только 2 (Sheppard, Berlocher, 1984) и из 30 - только 1 у пчел европейских популяций (Nunamaker, 1980), а у пчел башкирской популяции A.m.mellifera из 25 - только 3 (Косарева с соавт., 2000). Низкий уровень аллозимного полиморфизма был показан также для других представителей Hymenoptera (Metcalf et al., 1975; Lester,; Snyder, 1975; Pamilo et al., 1975; Selander, 1979). По причине низкой вариабельности аллозимов они не могли быть использованы в дальнейших популяционных исследованиях пчел A.mellifera, а также для различения подвидов (Mestriner, 1969; Badino et al., 1982; Cornuet, 1983; Sheppard, McPheron, 1986; Sheppard, Berlocher, 1984; Sheppard, 1988; Del Lama et al., 1988, 1990; Lobo et al., 1989; Meixner et al., 1994).
Первоначальные исследования генофонда пчел с использованием метода RFLP (полиморфизма длин рестрикционных фрагментов) проводились на тотальной митохондриальной ДНК (мтДНК). D.R.Smith, W.M.Brown (1988) показали генетические различия подвида A.m.mellifera от африканизированных пчел в США методом RFLP мтДНК эндонуклеазами BcII, EcoRI, NdeI, XbaI.
Открытие PCR (полимеразной цепной реакции) в 80-х годах (Mullis et al., 1994) сделало возможным изучение полиморфизма ДНК и привело к революции в области молекулярной биологии. В результате для изучения полиморфизма в популяциях пчел стали использовать модифицированный вариант RFLP, где происходит рестрикция амплифицированных фрагментов ДНК. H.G.Hall, D.R.Smith (1991) на основе RFLP анализа амплифицированных фрагментов генов CO-I и CO-II эндонуклеазами EcoRI, HincII, Xba I показали уровень генетической вариабельности популяции пчел Испании. На основе RFLP анализа амплифицированногго фрагмента межгенного локуса COI-COII мтДНК с использованием эндонуклеазы DraI была изучена генетическая структура популяции пчел Франции (Franck et al., 1998), Италии (Franck et al., 2000), Норвегии, Швеции, Дании, Шотландии, Англии, Ирландии (Jensen et al., 2005).
Параллельно с методом модифицированной RFLP в изучении генома пчел развивался метод RAPD (полиморфизм длин амплифицированных фрагментов со случайно выбранными праймерами). Метод RAPD нашел применение в исследованиях генома медоносной пчелы (Чудинов, 1999). С использованием метода RAPD G.J.Hunt и R.E.Page (1995) составили 26 групп сцепления и картировали гены определения пола, цвета тела и малат дегидрогеназы пчел.
Помимо метода RAPD в популяционных исследованиях пчел использовалась аллель-специфичная PCR. В нашем институте был разработан метод идентификации подвида A.m.mellifera на Урале в Республике Башкортостан на основе электрофоретического разделения в агарозном геле амплифицированных локусов межгенного локуса COI-COII мтДНК. Наша лаборатория также проводила поиск популяций подвида A.m.mellifera  на Южном и Среднем Урале на территории республики Башкортостан и Пермского края с ипользованием полиморфизма межгенного локуса COI-COII мтДНК (Сатаров, Николенко, 2000; Николенко, Поскряков, 2002) в результате чего были выделены сохранившиеся популяции A.m.mellifera  (Ильясов, 2005; Ильясов с соавт., 2006, 2007, 2008).
Методика изучения генетического полиморфизма популяций пчел на основе полиморфизма SSR (микросателлитных локусов) основана также на аллель-специфичной PCR. В последнее время полиморфизм микросателлитных локусов широко используется во всем мире в изучении генетической структуры и уровня вариабельности популяций пчел разными исследователями. Так A.Estoup et al. (1995) изучал эти вопросы на основе полиморфизма 7 микросателлитных локусов (B124, A7, A24, A113, A28, A88, A43), а P.Franck et al. (1998, 2000) на основе оценки полиморфизма 8 микросателлитных локусов в разных странах Европы, P.De La Rua et al. (2002) - на основе оценки полиморфизма 8 микросателлитных локусов в Северо-Восточной Италии, A.Jensen et al. (2005) - 11 микросателлитных локусов в Норвегии, Швеции, Дании, Шотландии, Англии, Ирландии. В нашей лаборатории Р.А.Ильясов (2006) и Ильясов с соавт., 2006, 2007, 2008 на основе полиморфизма 2 микросателлитных локусов (Ap243, 4a110) изучили генетическую вариабельность популяций пчел на Южном и Среднем Урале на территории Республики Башкортостан и Пермского края.
Секвенирование ДНК также является часто используемым методом в популяционно-генетических исследованиях пчел. J.-M.Cornuet et al. (1991) просеквенировали межгенный локус COI-COII мтДНК пчел и показали различия A.m.mellifera от других подвидов. После изобретения автоматического секвенатора стало доступным секвенирование большого количества образцов за сравнительно короткое время. M.C.Arias, W.S.Sheppard (1996) на основе секвенирования фрагмента гена ND2 мтДНК показали различия A.m.mellifera от других подвидов пчел в Европе. В нашей лаборатории Р.А.Ильясов с соавт. (2006) на основе секвенирования фрагмента гена ND2 мтДНК показали различия A.m.mellifera от южных подвидов пчел на Урале на территории республики Башкортостан. Совсем недавно сотрудники консорциума по секвенированию генома пчелы просеквенировали весь геном медоносной пчелы и показали различия между A.m.mellifera и другими подвидами (Weinstock et al., 2006). Было показано, что подвид A.m.iberica очень сходен с A.m.mellifera и при кластерном анализе группируются вместе.
Самым новым и многообещающим методом генетической анализа пчел является изучение полиморфизма SNP (однонуклеотидного полиморфизма), на основе чего можно будет составить генетический паспорт пчелы, очень быстро и дешево определить подвидовую принадлежность пчел и филогенетический паттерн. На сегодняшний день для медоносной пчелы известно несколько тысяч SNP (Whitfield et al., 2006).
Изучение генетической вариабельности в популяции пчел Урала и Поволжья было выполнено с использованием порядка 10 генетических маркеров. Оказалось, что пчелы не по всем маркерам обладают значительным полиморфизмом. Так микросателлитный локус ap049 в популяции пчел Башкортостана обладал очень незначительным полиморфизмом и в дальнейшем не был использован. Также отсутствовал полиморфизм длины у генов ND2 мтДНК, COI мтДНК и интрона гена EF1-α ядерной ДНК – у них наблюдается SNP полиморфизм, который выявляется только секвенированием. Полиморфизм этих генов также частично выявляется рестрикцией эндонуклеазой DraI. Значительным полиморфизмом обладали все остальные микросателлитные локусы – ap243, 4a110, A8, A113 ядерной ДНК. Очень интересный полиморфизм наблюдался у межгенного локуса COI-COII мтДНК, где мы обнаружили существование 4 гаплотипов (Q, PQ, PQQ и PQQQ). Кроме того, в популяции пчел Урала и Поволжья полиморфным является ген антибактериального пептида дефензина (Львов, 2002). Оказалось, что для большинства популяций пчел, где не происходит массовый ввоз семей, наблюдается некоторая доля инбридинга, тогда как в популяциях, в которые завозят пчел извне, наблюдается аутбридинг. По результатам исследований было опубликовано ряд работ в журналах «Пчеловодство» и «Генетика».
Лаборатория биохимии адаптивности насекомых Института биохимии и генетики Уфимского НЦ РАН заинтересована в расширении ареала исследований и числа анализируемых локусов пчел, а также в сотрудничестве с крупными и частными пчеловодными хозяйствами. По результатам тестов мы можем предоставить данные о генетической структуре, подвидовом составе, направлении генетических процессов и ходе эволюционных преобразований исследуемых пасек.
One of the main conditions for successful beekeeping is the knowledge of the genetic structure and the level of variability in the population of bees. Stability conditions of the population is in Hardy-Weinberg equilibrium, lack of gene flow between populations and the optimum level of genetic variability. The stability of the bee population is constantly violated under the influence of anthropogenic factors. Data on the structure of the gene pool can provide population-based studies.
Initially, population studies used only the analysis of morphometric characters. He laid the foundation G.A.Kozhevnikov (1900), who made measurements of the proboscis bees and proposed a method of measuring their chitin parts. Modern morphometric classification is based on the works of A.mellifera G.Goetze (1940), V.V.Alpatova (1948) and F.Ruttner et al. (1978). Also standard morphometry were obtained in our laboratory for the subspecies Ammellifera Bashkir population (Sattar, Nikolenko, 2002). However, it became clear that the morphometric methods often do not accurately identify the subspecies of the strong dependence of morphometric characteristics of bees on the environment and the level of intraspecific hybridization (Guzman-Novoa et al., 1994; Simankov, 1999; Roubik et al., 2001).
Subsequently, most of the researchers was the bees to pass on the use of molecular markers (Arias, Sheppard, 1996), giving a more precise, uniquely interpretable results compared with morphometric methods. The study of differences in the frequencies of alleles of enzymes, which is caused by genetic changes, at the end of the 60s was the basis of the method of studying bee populations using allozyme polymorphism (Richardson et al., 1986, Behura, 2006). For haplodiploid Heminoptera first predicted high level of polymorphism allozymes (Mestriner, 1969; Crozier, 1973; Tomaszewski et al., 1973; Contel et al., 1977). However, the honey bee A.mellifera was marked very low allozyme polymorphism, where 23 polymorphic enzymes appeared only 2 (Sheppard, Berlocher, 1984) and 30 - only 1 in bees European populations (Nunamaker, 1980), and the bees of the Bashkir Ammellifera population of 25 - only three (Kosarev et al., 2000). Low Allozyme polymorphism has been shown for other members of the Hymenoptera (Metcalf et al., 1975; Lester ,; Snyder, 1975; Pamilo et al., 1975; Selander, 1979). Due to the low variability allozymes they could not be used in further population studies bees A.mellifera, as well as to distinguish between subspecies (Mestriner, 1969; Badino et al., 1982; Cornuet, 1983; Sheppard, McPheron, 1986; Sheppard, Berlocher, 1984; Sheppard, 1988; Del Lama et al., 1988, 1990; Lobo et al., 1989; Meixner et al., 1994).
Initial studies of the gene pool of bees using the method of RFLP (restriction fragment length polymorphism) were carried out on a total of mitochondrial DNA (mtDNA). DRSmith, WMBrown (1988) have shown genetic differences Ammellifera subspecies of Africanized honey bees in the United States by mtDNA RFLP endonucleases BcII, EcoRI, NdeI, XbaI.
Opening of PCR (polymerase chain reaction) in 80 years (Mullis et al., 1994) has made it possible to study DNA polymorphism and led to a revolution in the field of molecular biology. As a result of studying polymorphism in bee populations started using a modified version of RFLP, where the restriction of the amplified DNA fragments. HGHall, DRSmith (1991) based on RFLP analysis of the amplified gene fragments CO-I and CO-II endonuclease EcoRI, HincII, Xba I showed a level of genetic variability bee population Spain. On the basis of RFLP fragment analysis amplifitsirovannoggo intergenic locus COI-COII mtDNA with endonuclease DraI was studied genetic structure of the population of bees in France (Franck et al., 1998), Italy (Franck et al., 2000), Norway, Sweden, Denmark, Scotland, England, Ireland (Jensen et al., 2005).
In parallel with the modified RFLP method in studying the genome of bees developed technique RAPD (amplified fragment length polymorphism with randomly selected primers). RAPD method has been applied in the study of the genome of the honey bee (Chudinov, 1999). Using the method of RAPD GJHunt and REPage (1995) amounted to 26 linkage groups and mapped the genes of sex determination, the color of the body and malate dehydrogenase bees.
In addition to the RAPD method in population studies of bees used allele-specific PCR. Our institute has been developed a method of identifying subspecies Ammellifera the Urals in the Republic of Bashkortostan on the basis of electrophoretic separation in an agarose gel of amplified loci intergenic locus COI-COII mtDNA. Our laboratory also conducted search Ammellifera subspecies populations in the South and Middle Urals, on the territory of the Republic of Bashkortostan and the Perm edge programs included with polymorphism intergenic locus COI-COII mtDNA (Satarov, Nikolenko, 2000; Nikolenko, Poskryakov, 2002) resulting in the marked surviving populations Ammellifera (Ilyasov, 2005; Ilyasov et al., 2006, 2007, 2008).
Method for studying the genetic polymorphism of bee populations on the basis of polymorphism SSR (microsatellite loci) is also based on allele-specific PCR. Recently, a polymorphism of microsatellite loci are widely used around the world in the study of the genetic structure and the level of variability of bee populations by different researchers. Thus A.Estoup et al. (1995) studied these questions on the basis of polymorphism of 7 microsatellite loci (B124, A7, A24, A113, A28, A88, A43), and P.Franck et al. (1998, 2000) based on an assessment of polymorphism 8 microsatellite loci in different European countries, P.De La Rua et al. (2002) - based on the assessment of polymorphism 8 microsatellite loci in the North-East of Italy, A.Jensen et al. (2005) - 11 microsatellite loci in Norway, Sweden, Denmark, Scotland, England, Ireland. In our laboratory R.A.Ilyasov (2006) and Ilyasov et al., 2006, 2007, 2008, based on microsatellite loci polymorphism 2 (Ap243, 4a110) studied the genetic variability of bee populations in the South and Middle Urals, on the territory of the Republic of Bashkortostan and the Perm edge .
DNA sequencing was also a frequently used method in population genetic studies of bees. J.-M.Cornuet et al. (1991) sequenced intergenic locus COI-COII mtDNA bees and showed differences Ammellifera from other subspecies. After the invention of the automatic sequencer made available sequencing of a large number of samples in a relatively short time. MCArias, WSSheppard (1996) on the basis of the gene sequencing fragment ND2 Ammellifera mtDNA showed no difference from other subspecies of bees in Europe. In our laboratory R.A.Ilyasov et al. (2006) based on the sequencing of the gene fragment ND2 mtDNA showed differences Ammellifera from the southern subspecies of bees on the territory of the Urals republic of Bashkortostan. Most recently, the staff of the consortium for sequencing the genome sequenced the entire genome of bee honey bee and showed differences between Ammellifera and other subspecies (Weinstock et al., 2006). It was shown that subtype Amiberica very similar to Ammellifera and cluster analysis are grouped together.
The most novel and promising method of genetic analysis is the study of bees polymorphism SNP (single nucleotide polymorphism), based on which it will be possible to make genetic passport bees very quickly and cheaply identify subspecies of bees and phylogenetic pattern. Today, for the honeybee are several thousand SNP (Whitfield et al., 2006).
The study of genetic variation in the population of bees of the Urals and the Volga region was performed using about 10 genetic markers. It was found that the bees do not all have significant polymorphism markers. So ap049 microsatellite loci in the population of bees Bashkortostan had very little polymorphism in the future has not been used. Also absent length polymorphism in mtDNA genes ND2, COI mtDNA and intron of EF1-α nuclear DNA - they observed SNP polymorphism, which is detected only by sequencing. Polymorphisms of these genes are also partly revealed by restriction endonuclease DraI. Significant polymorphism had all the other microsatellite loci - ap243, 4a110, A8, A113 nuclear DNA. Very interesting polymorphism observed in intergenic locus COI-COII mtDNA, where we discovered the existence of four haplotypes (Q, PQ, PQQ and PQQQ). In addition, the bee population of the Urals and the Volga is a polymorphic gene defensin antimicrobial peptides (Lviv, 2002). It was found that for the majority of bee populations, where there is no mass import of families there is some percentage of inbreeding, while the populations in which the bees are imported from outside, there is outbreeding. According to the research it published a number of papers in the journals "Beekeeping" and "Genetics".
Laboratory of Biochemistry adaptability insects Institute of Biochemistry and Genetics, Ufa Scientific Center, Russian Academy of Sciences is interested in expanding the area of ​​research and the number of loci analyzed bees, and in collaboration with major private and beekeeping farms. According to the results of tests we can provide information on genetic structure, subspecies composition, direction and progress of the genetic processes of evolutionary transformations studied apiaries.
  050. Шареева З.В., Ильясов Р.А., Поскряков А.В., Кутлин Н.Г., Николенко А.Г. Пчеловодствo северных районов Республики Башкортостан. Материалы международной научно-практической конференции "Инновации в пчеловодстве. Технологии, инвентарь, продукция". Сочи. 2009. С. 13-17.  

Пчеловодство является важной отраслью сельского хозяйства и служит источником для опыления энтомофильных культур, получения ценных пище-вых и лечебных продуктов и промышленного сырья. Пчеловодство – древнейшее занятие многих народов, а потому интерес к изучению этих насекомых со временем только возрастает. Одной из основных проблем последних десятилетий, решаемых на международном уровне, является межрасовая гибридизация. В России существует проблема гибридизации местных пчел с южными подвидами и сохранения генофонда среднерусских пчел Apis mellifera mellifera L. Данные вопросы рассматриваются не только отечественными (Линаск Э. А., 1989; Черевко Ю. А., 1995, 2005; Кривцов Н. И., 1995, 1996, 2005; Бородачев А.В., Савушкина Л.Н., 2007 и многие другие) и зарубежными исследователями (Franck et al., 1998; Arias, Sheppard, 1996; 2005; Jensen et al., 2005), но и решаются на уровне государств и республик (Закон Республики Башкортостан о пчеловодстве, 1995; указ Президента Республики Башкортостан №УП-685 «О развитии пчеловодства в Республике Башкортостан», 2003; Постановление прави-тельства Республики Башкортостан №223 о республиканской целевой про-грамме «Развитие пчеловодства в Республике Башкортостан», 2005).
По словам Черевко Ю. А. (2005), за последние 60-70 лет во многих регионах России и других странах произошла и происходит бессистемная метизация пчел, приведшая к необратимым процессам, препятствующим восстановлению первоначального исходного местного чистопородного материала. Начиная с тридцатых годов прошлого столетия южных пчел в большом количестве завозили в центральную зону России. Автор отмечает, что особый размах метизация пчел получила благодаря часто научно необоснованной пропаганде использования помесей для получения эффекта гетерозиса и бесконтрольному протеканию данного процесса. В результате сильно пострадала среднерусская пчела, которая практически исчезла в некоторых местах ее традиционного разведения.
Анализируя состояние генофонда среднерусских пчел, Кривцов Н.И. (2005) считает, что основания для тревоги есть, но положение не столь драматично. В Западной Европе вытеснение темной лесной пчелы началось еще раньше (около 150 лет назад) и шло интенсивнее, чем в России, тем не менее, в некоторых странах Западной Европы еще сохранились популяции темной европейской пчелы Apis mellifera mellifera. Для улучшения сложившейся ситуации, по мнению Кривцова Н.И., необходимо поставить вопрос о создании совета по пчеле среднерусской расы в рамках селекционно-информационного центра при НИИ пчеловодства.
Вопрос о сохранении аборигенной пчелы в первую очередь связан с ее преимуществами перед гибридными. Среднерусские пчелы обладают более высокой зимостойкостью, меньше реагируют на резкие колебания температуры. Весеннее развитие пчелиных семей начинается немного позже, а затем ее интенсивность быстро нарастает. По медопродуктивно-сти среднерусские пчелы в условиях бурного медосбора с липы, гречихи, вереска и других медоносов превосходят гибридных, испытываемых в этих условиях. Они обладают хорошей воскопродуктивностью и способностью приносить много пыльцы.
По данным Р.А.Ильясова с соавт. (2006) на Урале сохранились резерваты Apis mellifera mellifera L. в Бурзянском и Татышлинском районах Республики Башкортостан и Пермском крае. Мы решили продолжить поиск сохранившихся локальных популяций и задались целью исследовать для начала три северных района Республики Башкортостан: Бирский, Мишкинский и Караидельский. Интересен тот факт, что по результатам Саттарова В.Н. (2000) в Бирском районе в СПК «Ленина» более 50% пчел являлись гибридными.
Бирский, Мишкинский и Караидельский районы относятся к лесостеп-ной зоне северной подзоне Республики Башкортостан. Данная местность имеет облесенность от 25 до 70%, массивы которой представлены елово-пихтово-сосновым древостоем с примесью широколиственных: липы, березы, осины. Период медосбора недолгий, главный - приходится на июль. Безоблетное время длится до шести месяцев. Многие пчеловоды предпочитают зимовку на улице. В подобных условиях гибридным пчелам выжить нелегко (Власов, 1983).
По словам начальника Бирского межрайонного объединения (МРО) пчеловодства Н.М.Фаттахова (2008) пчеловодство в наших районах насчи-тывает многолетнюю историю. Люди занимались пчеловодством еще до ре-волюции, в том числе и во всех существующих монастырях. В период коллективизации многие пасеки были объединены в крупные колхозные. Для их обслуживания в северной зоне в 1948 году было организовано Бирское МРО пчеловодства. Позже были организованы Мишкинское и Караидельское МРО. Общее руководство пчеловодством осуществляла Башпчелоконтора при МСХ БАССР. Всего по Башкирии было 4 МРО: Уфимское, Стерлитамакское, Бирское и Туймазинское. Каждое из них обслуживало 14 районов.
В 1960-1970гг. был массовый завоз серых горных кавказских пчел в северные районы Республики Башкортостан для опытных целей, что позднее было запрещено. В эти годы пчеловодству уделялось большое внимание со стороны правительства. Было организовано производство ульев, построен воскоперерабатывающий завод. Каждую зиму с пчеловодами хозяйств проводилась учеба по повышению квалификации, для чего была создана школа пчеловодства, работала Башкирская опытная станция пчеловодства.
По данным Власова В.Н. (1983) в 1970-80гг. была налажена хорошая работа на матковыводных пасеках (1,5-2 тыс. маток) Мишкинского района. На пасеках Караидельского района проводилось испытание и использование дочерей от рекордисток и это показало, что такая селекция способствует улучшению полезных признаков местных пчел и обеспечивает устойчивую медопродуктивность рядовых пасек в последующие годы. От уровня племен-ной работы зависели качество семей и товарность пасек, увеличение производства высококачественного башкирского целебного меда.
Во времена перестройки многие колхозные пасеки были распроданы, зоотехнические службы – расформированы. Появились новые заготовители. МРО утратило свои позиции за отсутствием оборотных средств. С конца 2006 года каждый район работает самостоятельно. По мнению Фаттахова Н. М., настоящее время – время частного пчеловодства, что снижает возмож-ность контроля свыше, но не мешает анализировать их состояние.
Для исследований были отобраны пчелы с 42 пасек трех районов, не менее чем из 25% пчелосемей с пасеки. С каждой семьи брали по 5 рабочих особей, которых фиксировали в 96% этаноле и хранили в морозильной камере. ДНК выделяли из летательных мышц пчел по методу смесью гуанидинтиоционат-фенол-хлороформ (Chomezynski, Sacchi, 1987).
В анализе популяций в качестве генетического маркера использовали межгенный локус COI-COII мтДНК, полиморфизм которого был установлен ранее у представителей разных подвидов Apis mellifera (Cornuet et al., 1991). А.Г.Николенко и А.В.Поскряков (1998) ранее использовали этот полиморфизм в качестве маркера для различения подвидов A.m.mellifera и A.m.caucasica (Ильясов Р.А., 2006). Этот маркер был использован нами для поиска популяций A.m.mellifera.
Полимеразную цепную реакцию (ПЦР) проводили в термоциклере «Циклотерм» при оптимальном для каждого локуса температурном режиме. Выделенную ДНК проверяли на качество в агарозном геле и а продукты ПЦР электрофоретически фракционировали в полиакриламидном геле, после чего окрашивали бромистым этидием и фотографировали в трансиллюминаторе.
По исследуемым нами районам (Бирский, Мишкинский, Караидель-ский) анализ полиморфного межгенного локуса COI-COII мтДНК показал, что частота комбинации PQQ, характеризующего пчелу среднерусской расы, более 90%. Полученные нами данные позволяют говорить о сохранении среднерусских пчел в данных районах, куда ранее были завезены пчелы других подвидов из южных регионов России. Это позволяет предположить возможность восстановления аборигенного генофонда под воздействием факторов окружающей среды, куда можно включить и антропогенные факторы.
В настоящее время нами проводятся сравнительные популяционно-генетические исследования выделенных популяций с изучением полимор-физма микросателлитных локусов ядерного генома, так как митохондриаль-ная ДНК позволяет судить лишь о материнской наследственности.
Beekeeping is an important sector of agriculture and serves as a source for pollination of entomophilous crops, production of valuable food-O and medical products and industrial raw materials. Beekeeping - the oldest occupation of many nations, and because the interest in the study of these insects over time will only increase. One of the main problems of the last decades to be solved at the international level is the interracial hybridization. In Russia, there is a problem with the hybridization of native bees southern subspecies and genetic conservation Central Russian bee Apis mellifera mellifera L. These issues are addressed not only to domestic (Linask EA, 1989; Cherevko YA, 1995, 2005; NI Krivtsov 1995, 1996, 2005; Borodachev AV Savushkin LN, 2007 and many others) and foreign researchers (Franck et al., 1998; Arias, Sheppard, 1996; 2005; Jensen et al., 2005) but also solved at the level of states and republics (Law of the Republic of Bashkortostan on beekeeping, 1995 decree of the President of the Republic of Bashkortostan UP-685 "On the development of beekeeping in the Republic of Bashkortostan", 2003; Resolution of the Government was the Republic of Bashkortostan №223 of the republican target pro- Programme "Development of beekeeping in the Republic of Bashkortostan", 2005).
According Cherevko Yu (2005), for the last 60-70 years in many regions of Russia and other countries has occurred and there is unsystematic cross-breeding of bees, which led to an irreversible process, hindering recovery of the original source of local thoroughbred material. Since the thirties of the last century southern bees in large quantities were imported into the central zone of Russia. The author notes that the scope of a special cross-breeding of bees got through the often unscientific promoting the use of hybrids to produce the effect of heterosis and uncontrolled leakage of the process. As a result, I suffered greatly Central Russian bee, which has virtually disappeared in some areas of its traditional breeding.
Analyzing the gene pool of the Central Russian bees NI Krivtsov (2005) believes that there is cause for concern, but the situation is not so dramatic. In Western Europe, the displacement of the dark forest bees started even earlier (about 150 years ago) and went harder than in Russia, however, in some countries of Western Europe are still preserved populations dark European bee Apis mellifera mellifera. To improve the situation, according to NI Krivtsov, you must raise the question of the establishment of the Board of the Central Russian bee races in the framework of breeding and information center at the Institute of beekeeping.
The issue of preservation of native bees in the first place associated with its advantages over hybrid. Central Russian bees have higher winter hardiness, less responsive to rapid changes in temperature. The spring development of bee colonies begins a little later, and then its intensity rapidly increases. By Medoproduktivnost-sti Central Russian bees in terms of rapid medosbora with lime, buckwheat, heather honey plants and other superior hybrid tested in these conditions. They have a good voskoproduktivnostyu and the ability to bring a lot of pollen.
According R.A.Ilyasova et al. (2006) Urals preserved reserves Apis mellifera mellifera L. in Burzyan and Tatyshlinskom areas of the Republic of Bashkortostan and the Perm region. We decided to continue the search for the remaining local populations and set out to explore to begin the three northern region of the Republic of Bashkortostan: Birsky, Mishkinskoye and Karaidelsky. An interesting fact is that the results Sattarova VN (2000) Birsk area in the SEC "Lenin" over 50% of the bees is a hybrid.
Birsky, Mishkinskoye and Karaidelsky areas are forest-steppe zone of the North-term sub-zone of the Republic of Bashkortostan. The area has a forest cover of 25 to 70%, which shows arrays spruce-fir-pine stands with an admixture of deciduous: linden, birch, aspen. Medosbora short period, the main - is in July. Bezobletnoe time lasts up to six months. Many beekeepers prefer to winter in the street. In such circumstances the hybrid bees to survive is not easy (Vlasov, 1983).
According to the head of interdistrict Birsk Association (MPO) Beekeeping N.M.Fattahova (2008) Beekeeping in our neighborhoods naschi Pipeline long history. People engaged in beekeeping before re-revolution, including all existing monasteries. During the period of collectivization, many apiaries were merged into large collective farms. For their service in the northern zone in 1948 it was organized by the MPO Birsk beekeeping. Later they were organized and Mishkinskoye Karaidelskoe MPO. The general management of beekeeping in the Ministry of Agriculture carried out Bashpchelokontora BASSR. Total Bashkiria was 4 MPO: Ufa, Sterlitamak, and Birsk Tuymazinskoe. Each of them served 14 districts.
In 1960-1970gg. It was a massive importation of gray mountain Caucasian bees in the northern areas of the Republic of Bashkortostan for power purposes, which was later banned. During these years, beekeeping has received considerable attention from the government. It organized the production of beehives built voskopererabatyvayuschy plant. Every winter, beekeepers households conducted studies on professional development, which has created a school of beekeeping, worked Bashkir beekeeping Experiment Station.
According to Vlasov, VN (1983) in 1970-80gg. was arranged a good job on matkovyvodnyh apiaries (1,5-2 thousand. queens) Mishkinsky area. On apiaries Karaidelskogo District conducted testing and use of the daughters of rekordistok and it showed that this helps to improve the selection of useful traits of local bees and provides a stable medoproduktivnost ordinary apiary in the following years. From the level of tribes-term quality of the work depended families and marketability of apiaries, increasing the production of high-quality curative Bashkir honey.
During perestroika, many kolkhoz apiary were sold, livestock Service - disbanded. There are new collectors. MPO has lost its position in the absence of working capital. Since late 2006, each district operates independently. According Fattakhova NM, is now - time private beekeeping, which reduces the possibility of control over, but does not prevent analyze their condition.
For the study were selected from 42 apiaries bee three areas of at least 25% of bee colonies from the apiary. Each family took 5 working specimens which were fixed in 96% ethanol and stored in a freezer. DNA was isolated from muscle flying bee method guanidintiotsionat mixture phenol-chloroform (Chomezynski, Sacchi, 1987).
In the analysis of the population as a genetic marker used intergenic locus COI-COII mtDNA polymorphisms which was previously set at representatives of different subspecies of Apis mellifera (Cornuet et al., 1991). A.G.Nikolenko and A.V.Poskryakov (1998) have previously used this polymorphism as a marker to distinguish between subspecies and Ammellifera Amcaucasica (Ilyasov RA 2006). This marker was used to search for our populations Ammellifera.
Polymerase chain reaction (PCR) was performed in a thermal cycler "Tsikloterm" at the optimum temperature for each locus mode. The isolated DNA was checked on quality agarose gel and PCR products were fractionated electrophoretically in a polyacrylamide gel, then stained with ethidium bromide and photographed in transilluminator.
In the studied areas (Birsky, Mishkinskoye, Karaidel-sky) an analysis of polymorphic intergenic locus COI-COII mtDNA showed that the frequency combination of PQQ, which characterizes Central Russian bee race, more than 90%. Our data suggest the Central Russian bees in maintaining these areas, where the bees were brought before other subspecies of the southern regions of Russia. This suggests the possibility of restoring the indigenous gene pool under the influence of environmental factors, which can be switched on and anthropogenic factors.
Currently, we carry out a comparative population genetic studies dedicated to the study of population polymorphism-phism microsatellite loci of the nuclear genome, as mitochondrial DNA Nye gives an indication only of maternal inheritance.
  051. Ильясов Р.А., Шареева З.В., Кутлин Н.Г., Поскряков А.В., Николенко А.Г. Изучение границ ареала медоносной пчелы Apis mellifera mellifera на Южном Урале. Аграрная Россия. Специальный выпуск. 2009. С. 37.  

Изучение границ ареала медоносной пчелы Apis mellifera mellifera на Южном Урале (A study of the boundaries of the area of the honey bee Apis mellifera mellifera in the South Urals) Пчелы с пасек Бирского района характеризовались частотой встречаемости комбинации PQQ 0,94, тогда как пчелы пасек двух других районов — 0,98. Такое значение частоты комбинации PQQ в популяции пчел Бирского района противоречит данным В. Н. Саттарова (2000) и говорит о том, что пчелы среднерусской расы представлены гораздо шире на Южном Урале. Полученные нами данные позволяют говорить о сохранении среднерусских пчел в данных районах, несмотря на завоз пчел других подвидов из южных регионов России несколько десятков лет назад. Это позволяет предположить о существовании вероятности восстановления аборигенного генофонда под воздействием факторов окружающей среды, куда можно включить и антропогенные факторы. Возможно, что ареал распространения пчел среднерусской расы гораздо шире, чем мы предполагаем на данный момент. Нами планируются дальнейшие исследования популяции пчел Южного Урала.
Bee apiaries with Birsk area characterized frequency of occurrence of combinations PQQ 0,94, then bees apiaries two other areas - 0.98. such a frequency combination of PQQ in bee populations The Siberian region contradicted by VN Sattarova (2000) and suggests that the bees of Central race presented a much wider in the southern Urals. Our data suggest a maintaining the Central Russian bees in these areas, despite on the importation of bees other subspecies from southern regions Russia a few decades ago. this allows suggest the existence of a probability restoration of native gene pool under the influence environmental factors, which can be enable and anthropogenic factors. Perhaps distribution area of the Central Russian bees race much wider than we assume for the moment. We are planning to further study population bees Southern Urals. Publication Name: Ilyasov R.A., Shareeva ZV, Kutlin NG, Poskryakov A.V. Nikolenko A.G. A study of the boundaries of the area of the honey bee Apis mellifera mellifera in the South Urals. Agrarian Russia. Special Issue. 2009, P. 37-38.
  052. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Ареал распространения бурзянской популяции башкирской пчелы. Материалы II международной научной конференции "Актуальные проблемы экологической физиологии, биохимии и генетики животных". Саранск. 2009. С. 61-63.

 Задачей нашего исследования является изучение популяций пчел южной части ареала башкирской пчелы. Ранее проведенные нами исследования показали, что башкирские пчелы по таксономии относятся к подвиду A.m.mellifera. Первоначально единственным местом сохранения чистых линий этой пчелы считался небольшой регион на юге Башкортостана, входящий в состав заповедника «Шульган-Таш» Республики Башкортостан. Дальнейшие исследования относились преимущественно к северной части ареала башкирской пчелы и не было проведено каких-либо исследований в обнаруженной первоначально популяции A.m.mellifera южной части ареала. Ареал этой южной локальной популяции не определен в точности, а именно, совпадает ли ареал с границами Бурзянского района или он гораздо шире.
Для исследования были отобраны пчелы из 5 выборок: с. Старосубхангулово (10 семей), с. Новомусятово (10 семей), с. Иргизлы (10 семей) Бурзянского района, с. Крутой Лог (5 семей) Абзелиловского района, с. Сюрень (4 семьи) Кугарчинского района Республики Башкортостан (рис. 1). В исследовании были использованы: локус COI-COII мтДНК, микросателлитные локусы ap243, 4a110, a8, a43 ядерной ДНК. Нами были рассчитаны частоты встречаемости аллелей каждого локуса.
Частоты встречаемости комбинаций межгенного локуса COI-COII мтДНК были следующими: в популяциях пчел всех выборок, кроме Сюрени, комбинация PQQ (маркер A.m.mellifera) встречалась с частотой 1,0, тогда как в Сюрени встречалась только комбинация Q (маркер A.m.caucasica) с частотой 1,0.  Для получения информации о распределении популяций необходимо рассчитать частоты аллелей и генетические расстояния. Наиболее приемлемым расстоянием является генетическое расстояние M. Nei (1978).
На основе данных о частотах распределения аллелей были рассчитаны генетические расстояния. Наибольшие расстояния наблюдается между популяциями Сюрень и Крутой Лог; Сюрень и Старосубхангулово. Наименьшие расстояния - между Крутой Лог и  Новомусятово; Старосубхагулово и  Новомусятово. Такая группировка, в некоторой степени согласована как с географическим расположением, так и генетическим составом этих популяций. В дальнейшем, был проведен кластерный анализ с использованием метода ближайшего соседа и построена дендрограмма (рис. 2). Так, популяция Сюрень отделяется от всех, так как в ней представлены в основном гибридные семьи пчел. Таким образом, картина кластерного анализа может отражать до некоторой степени уровень миграции между популяциями, где наиболее близкие популяции будут близки и генетически, тогда как отдаленные популяции будут более изолированы друг от друга.
Таким образом, проведенные исследования позволяют сделать вывод о том, что ареал обитания бурзянской популяции башкирской пчелы A.m.mellifera, возможно имеет расширение в восточном направлении в сторону Абзелиловского района, тогда как на юге в Кугарчинском районе популяция была подвержена значительной гибридизации.
The aim of our research is to study the bee populations of southern part of the range of Bashkir bee. Earlier studies have shown us that the Bashkir bee taxonomy are subspecies Ammellifera. Initially, the only place save the clean lines of the bees was considered a small region in the south of Bashkortostan, which is part of the reserve "Shulgan-Tash" of the Republic of Bashkortostan. Further studies are concerned mainly to the northern part of the range of Bashkir bee and was not carried out any research in the detected initial population Ammellifera southern part of the range. The area south of the local population is not defined precisely, but it coincides with the boundaries of any area or district Burzyansky it is much wider.
For the study were selected from bees 5 samples: p. Starosubhangulovo (10 families), p. Novomusyatovo (10 families), p. Irgizly (10 families) region Burzyansky with. Krutoy Log (5 families) region Abzelilovsky with. Suresnes (4 families) region of the Republic of Bashkortostan Kugarchinskogo (Fig. 1). The study used: locus COI-COII mtDNA microsatellite loci ap243, 4a110, a8, a43 nuclear DNA. We calculated the frequency of alleles for each locus.
The frequency of occurrence of combinations intergenic locus COI-COII mtDNA were as follows: in populations of bees of all samples except Suresnes combination PQQ (marker Ammellifera) occurs with a frequency of 1.0, whereas in Suresnes met only the combination Q (marker Amcaucasica) with frequency 10. For information on the distribution of populations is necessary to calculate allele frequencies and genetic distances. The most acceptable is genetic distance distance M. Nei (1978).
Based on the distribution of allele frequencies were calculated genetic distance. The greatest distance observed between populations of Suresnes and Krutoy Log; Suresnes and Starosubhangulovo. The shortest distance - between Krutoy Log and Novomusyatovo; Starosubhagulovo and Novomusyatovo. This grouping, to some extent consistent with both the geographical location and the genetic composition of populations. Subsequently, a cluster analysis was performed using the nearest neighbor method and a dendrogram constructed (Fig. 2). Thus, the population is separated from all of Suresnes, since it contains mainly hybrid bee colonies. Thus, the picture cluster analysis may reflect to some degree the level of migration between populations where populations are closest and genetically close, while more distant populations are isolated from each other.
Thus, our studies suggest that habitat Burzyan Bashkir bee populations Ammellifera, perhaps has the extension eastwards towards Abzelilovsky area, while in the south district Kugarchinskom population exposed to significant hybridization.
  053. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Происхождение и эволюция медоносной пчелы Apis mellifera. Материалы докладов XXIII Любищевских чтений "Современные проблемы эволюции". Ульяновск. 2009. С. 171-172.

Изучение истории возникновения рода Apis, к которому относится и медоносная пчела Apis mellifera, представляет большой научный интерес. Первоначально, на основе морфометрической классификации A.mellifera, было выделено 25 подвидов. В дальнейшем, на основе биохимической и генетической классификации, было показано, что действительно существует подразделенность на 25 подвидов, которые делятся на 5 эволюционных ветвей. Существуют разногласия о ходе расселения пчел по всей территории современного ареала.
Studying of origin history of genus Apis, which belong honey bee Apis mellifera was had large scientific interest. Originally, on the basis of morphometric classification of A.mellifera 25 subspecieses were selected. Furter, on the basis of biochemical and genetic classification, it was shown differentiation indeed to 25 subspecies which divide to 5 evolutional branches. There are disagreements about motions of bees on all territory on modern area.
  054. Шареева З.В., Ильясов Р.А., Поскряков А.В., Кутлин Н.Г., Николенко А.Г. Структура популяциии северного ареала башкирской пчелы Apis mellifera mellifera L. на основе фенотипических и генотипических исследований. Естественные и технические науки. № 2 (40). 2009. С. 111-116.  

Структура популяциии северного ареала башкирской пчелы Apis mellifera mellifera L. на основе фенотипических и генотипических исследований (Structure of the populations of northern area of the Bashkir bee Apis mellifera mellifera L. on the basis of phenotypic and genotypic tests) Проблема гибридизации темной лесной пчелы с южными подвидами и сохранение генофонда среднерусских пчел А. т. mellifera более полувека является основной в развитии пчеловодства России. Для решения этой проблемы применяются как классические, так и современные молекулярно-генетические методы идентификации подвидовой принадлежности медоносных пчел. Полученные нами результаты сравнительных популяционно-генетических исследований северного ареала башкирской пчелы А.т.mellifera показали, что сочетание относительно высоких долей морфотипа М и частот PQ, PQQ, PQQQ может свидетельствовать о том, что процессы гибридизации не зашли еще далеко, и, при определенных усилиях, возможно создание еще одного резервата Apis mellifera mellifera на территории РБ. Более детальный поиск островков генофонда Apis mellifera mellifera целесообразен на наш взгляд и в других северных районах РБ. Таким образом, из проведенного исследования можно заключить, что островная популяция башкирских пчел подвида А. т. mellifera сохранилась на севере республики Башкортостан и имеет очень широкое распространение локальных популяций — от юга (Бурзянский район) до севера (Татышлинский район). Безусловно, популяция неоднородна, встречаются большие очаги гибридизации. Также необходимо отметить, что для проведения подобных исследований предпочтительно использовать различные методы, так как комплексный анализ данных дает более полное представление о структуре популяции. Problem hybridization dark forest bees with the southern subspecies and preservation of the gene pool Central Russian bees A. m. mellifera over half a century is a key in the development of beekeeping Russia. To solve this problem, apply both classic and modern molecular genetic methods for identifying subspecies of honey bees. Our results of comparative population genetic Research northern area of the Bashkir bee A.t.mellifera showed that the combination of relatively high proportion of morphotype M and frequency PQ, PQQ, PQQQ may indicate that the processes of hybridization are not logged in yet far away, and, with some effort, it is possible the creation of another reserve Apis mellifera mellifera on the territory of Belarus. A more detailed Search islands gene pool Apis mellifera mellifera is appropriate in our opinion and in other northern areas of the Republic of Belarus. Thus, from this study it can be concluded that the island population Bashkir bee subspecies A. m. mellifera preserved in the north of the Republic of Bashkortostan and has a very wide distribution of local populations - from the south (Burzyansky District) to the north (Tatyshlinsky District). Of course, the population is heterogeneous, there are large pockets of hybridization. Also it should be noted that for such studies is preferable to use a variety of methods, as a comprehensive analysis of data provides a more complete picture of the structure of the population. Publication Name: Shareeva ZV, Ilyasov R.A., Poskryakov A.V. Kutlin NG, Nikolenko A.G. Structure of the populations of northern area of the Bashkir bee Apis mellifera mellifera L. on the basis of phenotypic and genotypic tests. Natural and technical sciences. V. 2 (40). 2009, P. 111-116.

  055. Ильясов Р.А., Поскряков А.В. Стабильность генетических характеристик пчел A.m.mellifera башкирской популяции на севере ареала. Материалы международной конференции молодых ученых "Инновации молодых ученых - основа устойчивого развития регионов". Уфа. 2009. С. 27-28.  

В статье приводятся выводы изучения полиморфизма локальных популяций башкирской пчелы, обитающих на северной границе ареала с использованием трех микросателлитных локусов ядерной ДНК. В данных популяциях мы наблюдали незначительное отклонение распределения генотипов от ожидаемого по Хади-Вайнбергу в сторону дефицита гетерозигот, что обусловлено особенностями обитания пчел.
Уральская популяция темной европейской пчелы Apis mellifera mellifera уникальна своим генофондом, который был сформирован длительным жестким естественным отбором в горных лесах в условиях продолжительных зимних периодов с критически низкими температурами. Башкирская пчела подвида A.m.mellifera является уникально адаптированной к холодной продолжительной зиме, к сопутствующим болезням, а также к бурному кратковременному летнему взятку. Популяция башкирских пчел подвержена значительному влиянию человека, в результате чего ее генофонд изменяется. Условием продолжительного существования популяции пчел в пределах своего ареала является стабильность популяционно-генетических процессов и характеристик. Основной характеристикой популяции пчел является уровень генетической гетерогенности, которая измеряется как уровень биоразнообразия и гетерозиготности. Важной характеристикой стабильности популяции пчел является неизменность генетических характеристик во времени. Небольшое отклонение от ожидаемого значения по Харди-Вайнбергу может также служить характеристикой относительного постоянства генофонда, как и в случае отсутствия отклонений [1, c. 680].
Мы изучили пчел из 91 семьи Бирского, 53 семей Мишкинского, 30 семей Татышлинского и 65 семей Караидельского районов республики Башкортостан, охватывающие северную часть ареала башкирской пчелы. Мы показали, что популяции пчел этих районов в большинстве содержат семьи башкирских пчел подвида A.m.mellifera, хотя изредка встречаются семьи гибридного происхождения. Гибридные пчелы нежелательны в условиях Урала, так как они плохо приспособлены к местным условиям и могут привести к убыткам и дополнительным денежным расходам для поддержания их жизнедеятельности.
По результатам анализа полиморфизма микросателлитных локусов ар243, 4а110 и А8 ядерной ДНК в этих популяциях пчел можно сказать, что отмечалась относительная стабильность генетических характеристик, то есть не наблюдалось значительных различий между наблюдаемым и ожидаемым значениями гетерозиготности. Это показатель генотипического равновесии в изучаемых популяциях пчел. Небольшой дефицит гетерозигот обусловлен, возможно, особенностями их обитания и разведения, а различия генетических характеристик среди локусов - особенностями распределения генотипов каждого локуса.
The article presents the findings of the study of polymorphism of local populations Bashkir bees living on the northern border of the area using three microsatellite loci of nuclear DNA. In these populations, we observed a slight deviation from the expected distribution of genotypes for Hadi-Weinberg towards heterozygote deficiency, due to the peculiarities of bees habitat.
Ural population dark European bee Apis mellifera mellifera is unique in its gene pool, which was formed a long hard by natural selection in the mountain forests in the conditions of long winters with critically low temperatures. Bashkir bee subspecies Ammellifera is uniquely adapted to the cold and long winter, to related diseases, as well as to rapid short-term summer bribe. Bashkir bee population exposed to significant human impact, resulting in her gene pool changes. The condition for the continued existence of the bee population within its range is the stability of population genetic processes and characteristics. The main characteristic of the bee population is the level of genetic heterogeneity, which is measured as a level of biodiversity and heterozygosity. An important characteristic of the stability of the bee population is the immutability of genetic characteristics in time. A small deviation from the expected value for Hardy-Weinberg could also serve as a characteristic of relative constancy of the gene pool, as well as in the absence of abnormalities [1, c. 680].
We studied 91 families of bees Birsk, Mishkinsky 53 families, 30 families and 65 families Tatyshlinskogo Karaidelskogo areas of the Republic of Bashkortostan, covering the northern part of the range of Bashkir bee. We've shown that the bee population in most of these areas include family Bashkir bee subspecies Ammellifera, although occasionally there are families of hybrid origin. The hybrid bees are undesirable in terms of the Urals, as they are ill-suited to local conditions and can lead to losses and additional cash costs to maintain their livelihoods.
According to the analysis of polymorphism of microsatellite loci ar243, 4a110 and A8 nuclear DNA in these populations of bees can say that relative stability observed genetic characteristics, that is, there were no significant differences between the observed and expected heterozygosity values. It is a measure genotypic equilibrium in the studied populations of bees. A small deficit of heterozygotes is due, perhaps, the peculiarities of their habitat and breeding and genetic characteristics differences among loci - especially the distribution of genotypes of each locus.
  056. Ильясов Р.А., Шареева З.В., Поскряков А.В., Кутлин Н.Г., Николенко А.Г. Пчелы северных районов республики Башкортостан. Материалы II Международной научно-практической конференции "Актуальные вопросы энтомологии". Ставрополь. 2009. Выпуск 5. С. 12-16.  

Для определения распространения A.m.mellifera в северной части ареала башкирской пчелы нами было проведено изучение популяций пчел с 42 пасек трех северных районов республики Башкортостан (Бирский, Караидельский, Мишкинский) с использованием морфометрических и молекулярно-генетических методов. Мы показали, что популяция башкирской пчелы подвида A.m.mellifera сохранилась в значительном количестве на территории республики Башкортостан и имеет довольно широкое географическое распространение. Северная часть ареала башкирской пчелы имеет большую протяженность, чем предполагалось ранее.
For determination of distribution of A.m.mellifera in north part of natural areal of bashkir bee we studied of bees populations from 42 apiaries from three northern regions of the Bashkortostan republic (Birski, Karaidelski, Мyshkinski) using morphometric and molecular-genetic methods. We showed that population of bashkir bee of subspecies A.m.mellifera was saved in generous amount in Bashkortostan republic and has wide geographical distribution. North part of natural habitat of bashkir bee has a greater extent, than was assumed before.
  057. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Внутривидовая подразделенность медоносной пчелы вида Apis mellifera L. Материалы международной научной конференции "Синтетическая теория эволюции: состояние, проблемы, перспективы". Луганск. 2009. С. 32-34.  

Вид Apis mellifera L. занимал обширный ареал, включающий Африку, Европу и Ближний Восток. В последнее время в результате антропогенной деятельности возникли гибридные популяции, далеко отстоящих друг от друга популяций, которые в естественных условиях не встречаются друг с другом.
В результате морфометрических исследований F.Ruttner (1992) выделил 25 подвидов Apis mellifera L. (см. рис.) Большое число подвидов обусловлено, по-видимому, изоляцией и последующим накоплением генетических различий. В Европе такая изоляция могла возникнуть в результате оледенения в Плейстоценовый период (Ruttner, 1992). В Африке изоляция, возможно, происходила в результате процессов опустынивания, а также наличия естественных преград в виде горно-лесных массивов. Так, A.m.sahariensis была изолирована процессами опустынивания, а A.m.monticola – горно-лесными массивами (Arias, 1996). F.Ruttner с соавт. (1978) морфометрическими исследованиями показали разделение Apis mellifera L. на четыре подвидовые группы: A, M, C и O.
Группа А, включала африканские подвиды: A.m.lamarckii, A.m.yemenitica, A.m.litorea, A.m.scutellata, A.m.monticola, A.m.adansonii, A.m.unicolor, A.m.capensis. Группа М включала подвиды из Северной Европы, Пиренейского полуострова и Северной Африки: A.m.mellifera, A.m.iberica, A.m.intermissa, A.m.sahariensis, A.m.major. В группу С входят подвиды из Восточной Европы, Северного Средиземноморья, Центральной и Восточной Европы, Балканского полуострова и Кавказа. Позже F. Ruttner (1988, 1992) разделил группу С на две С и О. В новую группу С стали входить подвиды из Центральной и Восточной Европы и Балканского полуострова: A.m.ligustica, A.m.carnica, A.m.macedonica, A.m.cecropia, A.m.sicula. Группа О является основной группой подвидов с Кавказа, Средиземноморья и Ближнего Востока: A.m.caucasica, A.m.armeniaca, A.m.meda, A.m.anatoliaca, A.m.syriaca, A.m.cypria, A.m.adami.
Современные исследования показали низкий уровень аллозимного полиморфизма A.mellifera в Турции (Kandemir с соавт., 2000) и заповеднике “Шульган-Таш” (Янбаев с соавт., 2000). По этой причине аллозимы не могут быть успешно использованы в филогенетических исследованиях.
Первые успехи в филогенетике, систематике и поиске маркеров были сделаны в RFLP мтДНК (Smith, 1988; Smith с соавт., 1989,1991; Arias с соавт., 1990; Sheppard с соавт., 1991; Garnery с соавт., 1993; Meixner с соавт., 1993), RAPD анализе (Blanchetot, 1991, 1992; Hunt, Page, 1995), исследовании микросателлитных повторов (Tares с соавт., 1993; Estoup с соавт., 1995), секвенционном анализе мтДНК (Arias с соавт., 1996) и RFLP ядерного генома (Hall, 1998).
Исследования D.R.Smith (1991) с использованием метода RFLP и J.M.Cornuet с соавт. (1991), L.Garnery с соавт. (1992) методом секвенирования мтДНК показали филогенетическую картину, где подтверждается наличие четырех подвидовых групп Apis mellifera L., как и у F.Ruttner с соавт. (1978). Однако группы М и О F. Ruttner с соавт. (1978) по составу значительно отличаются. Работа M.Arias с соавт. (1996) с применением секвенса митохондриальной ДНК подтверждает предыдущие результаты молекулярно-генетичеких исследований.
A.Estoup с соавт. (1995) в своих исследованиях по семи микросателлитным локусам A113, B124, A7, A24, A28, A88, A43 подтвердил существование и состав трех эволюционных ветвей, первоначально выделенных F.Ruttner (1988), где каждая ветвь представлена тремя различными образцами, принадлежащими семи различным подвидам трех эволюционных ветвей F.Ruttner (1978) M, C, A. Ветвь M представлена тремя популяциями из Avingon (Южная Франция, A.m.mellifera L.), Valenciennes (Северная Франция, A.m.mellifera L.) и Umea (Швеция, A.m.mellifera L.). Ветвь С представлена популяцией из Forli (Италия, A.m.ligustica), Berlin (Германия, A.m.carnica), Chalkidiki (Греция, A.m.cecropia). Ветвь А представлена популяциями из Johannesburg (Южная Африка, A.m.scutellata), Cape Town (Южная Африка, A.m.capensis) и Tinznit (Марокко, A.m.intermissa). Эти результаты были получены с использованием различных дистанций – Cavalli-Sforza и Edwards, Das, Fst. Образцы A.m.intermissa из Морокко меняют свое положение в зависимости от использования различных методов оценки генетических дистанций. Так, при использовании стандартного генетического расстояния M. Nei (1975) A.m.intermissa принадлежит ветви М, а при использовании минимальной дистанции M. Nei (1975) – ветви А. Поэтому более приемлем тот результат, где A.m.intermissa принадлежит ветви М, соответственно результатам морфометрии F. Ruttner с соавт. (1978).
M.Arias c соавт. (1996) в своей работе также показали подразделение подвидов пчел на четыре группы, где группа I содержит преимущественно африканские подвиды, которые могут быть разделены на две подгруппы: северную I-N (A.m.intermissa, A.m.sahariensis, A.m.sicula, A.m.iberica) и южную I-S (A.m.capensis, A.m.adansonii, A.m.scutellata, A.m.monticola). Хотя A.m.sicula, A.m.iberica не обитают на африканском континенте, они все же кластеризуются в эту группу, благодаря их единому происхождению, что подтверждает гипотезу F.Ruttner с соавт. (1978) о родстве пчел Пиренейского полуострова и Северной Африки. Исследования A.Badino с соавт. (1985), L.Garnery с соавт. (1993) также подтверждают такое родство. Африканизированные пчелы из Бразилии кластеризуется с южной африканской группой, так как они являются потомками A.m.scutellata. A.m.adansonii и A.m.scutellata объединяются вместе, так как, по предположению M.Arias c cоавт. (1996), между ними существует поток генов в результате отсутствия географического барьера. Группа II состоит из A.m.lamarckii и A.m.meda. M.Arias с соавт. (1996) предполагают, что эта группа должна объединять подвиды Среднего Востока и северо-восточной Африки. A.m.syriaca и A.m.yemenitica, возможно, также будут входить в эту группу. Подвиды A.m.mellifera и A.m.ligustica формируют группу III. Образцы A.m.ligustica из этой группы характеризуются морфометрически как A.m.ligustica, а рестрикция мтДНК EcoRI показывает гаплотип A.m.mellifera. A.Badino с соавт., (1984) и A.Manino с соавт. (1984), используя аллозимный анализ, сообщают, что на территории западной Италии происходит естественный вторичный контакт между подвидами A.m.ligustica и A.m.mellifera. B.P.Oldroyd с соавт. (1992), работая с популяцией пчел острова Кенгуру, показал, что пчелы, морфометрически и по аллозимным данным классифицированные как A.m.ligustica, показали гаплотип A.m.mellifera при использовании рестрикции EcoRI мтДНК. Популяция пчел острова Кенгуру была образована из пчел, которые были завезены из Австралии и Италии в прошлом веке (Woodward, 1993, 1994, 1996). Видимо, пчелы были изначально гибридизованы еще в Италии. M.D.Meixner с соавт. описали интрогрессию популяций A.m.ligustica и A.m.carnica в северо-восточной Италии, Словении и Австрии морфометрическими и митохондриальными маркерами. J.M.Cornuet (1982), J.M.Cornuet с соавт. (1989), D.R.Smith с соавт. (1991) морфометрическими, аллозимными и RFLP мтДНК данными показали, что на территории Испании находится зона гибридизации между подвидами A.m.mellifera и A.m.intermissa. Кроме того, нельзя игнорировать роль человека в интродукции и селекции подвидов. Группу IV составляют подвиды Средиземноморья: A.m.macedonica, A.m.ligustica, A.m.carnica и A.m.meda. Два образца A.m.meda в работе M.Arias и W.Sheppard (1996) располагаются в разных группах: один с африканскими подвидами, другой с северо-средиземноморскими подвидами, что подтверждает гипотезу, что ареал его текущего обитания (Сирия, Иран, Ирак и Турция) может быть центром происхождения видов (Ruttner, 1988; Garnery с соавт., 1992; Arias and Sheppard, 1996).
Африканской группе подвидов (группа I) соответствует предложенная Ruttner с соавт. (1978) группа А; группе подвидов северного Средиземноморья (группа IV)– группа С; и A.m.mellifera (группа III) – группа М. В работе M.Arias и W.Sheppard (1996) группа IV соответствует группе С, исключая A.m.meda, которая по F. Ruttner (1988) принадлежит группе О.
М. Arias с соавт. (1996) подтверждают аналогию группы II с группой О F.Rutter (1988). Однако их сходство только внешне, а по составу они различны. Группа О содержит A.m.meda, но не содержит A.m.lamarckii. Гипотезу родства по происхождению подвидов Среднего Востока и Африки подтверждает состав группы II, которая объединяет A.m.lamarckii из Египта и A.m.meda из Сирии. Исследование дополнительных подвидов из Турции, восточного Средиземноморья и Кавказа, таких как A.m.anatoliaca и A.m.caucasica позволит решить этот вопрос родства подвидов.
Type of Apis mellifera L. occupies a vast area that includes Africa, Europe and the Middle East. Recently, as a result of human activities having hybrid populations far removed from each other populations that do not naturally occur together.
As a result, morphometric studies F.Ruttner (1992) identified 25 subspecies Apis mellifera L. (see. Fig.) A large number of subspecies due, apparently, isolation and subsequent accumulation of genetic differences. In Europe, this isolation could occur as a result of glaciation in the Pleistocene period (Ruttner, 1992). In Africa, the insulation may have occurred as a result of desertification, as well as the presence of natural barriers in the form of mining and forest. So, Amsahariensis was isolated by desertification and Ammonticola - mountain forest (Arias, 1996). F.Ruttner et al. (1978) morphometric study showed the separation of Apis mellifera L. subspecies into four groups: A, M, C and O.
Group A included the African subspecies: Amlamarckii, Amyemenitica, Amlitorea, Amscutellata, Ammonticola, Amadansonii, Amunicolor, Amcapensis. Group M subtypes included from Northern Europe, the Iberian Peninsula and North Africa: Ammellifera, Amiberica, Amintermissa, Amsahariensis, Ammajor. Group C includes subspecies of Eastern Europe, Northern Mediterranean and Central and Eastern Europe, the Balkans and the Caucasus. Later F. Ruttner (1988, 1992), divided into two group C C and D. The new group began to enter the sub-species of the Central and Eastern Europe and the Balkans: Amligustica, Amcarnica, Ammacedonica, Amcecropia, Amsicula. Group O is a core group of subspecies of the Caucasus, the Mediterranean and the Middle East: Amcaucasica, Amarmeniaca, Ammeda, Amanatoliaca, Amsyriaca, Amcypria, Amadami.
Recent studies have shown a low level of allozyme polymorphism A.mellifera Turkey (Kandemir et al., 2000) and preserve "Shulgan-Tash" (Yanbaev et al., 2000). For this reason, allozymes can not be successfully used in phylogenetic studies.
The first successes in phylogenetics, taxonomy and search markers were made in RFLP of mtDNA (Smith, 1988; Smith et al., 1989,1991; Arias et al., 1990; Sheppard et al., 1991; Garnery et al., 1993; Meixner et al., 1993), RAPD analysis (Blanchetot, 1991, 1992; Hunt, Page, 1995), study of microsatellite repeats (Tares et al., 1993; Estoup et al., 1995), the analysis of mtDNA sekventsionnom (Arias et al. , 1996), and RFLP nuclear genome (Hall, 1998).
Studies DRSmith (1991) using the method of RFLP and JMCornuet et al. (1991), L.Garnery et al. (1992) demonstrated by sequencing the mtDNA phylogenetic picture, which confirms the presence of four groups of subspecies Apis mellifera L., like F.Ruttner et al. (1978). However, the group M and O F. Ruttner et al. (1978) differ significantly in composition. Work M.Arias et al. (1996) using mitochondrial DNA Sequence confirms previous results genetichekih molecular studies.
A.Estoup et al. (1995) in their studies on seven microsatellite loci A113, B124, A7, A24, A28, A88, A43 confirmed the existence and composition of the three branches of evolution, originally allocated F.Ruttner (1988), where each branch is represented by three different samples belonging to seven different subspecies three evolutionary branches F.Ruttner (1978) M, C, A. M branch is represented by three populations of Avingon (Southern France, Ammellifera L.), Valenciennes (Northern France, Ammellifera L.) and Umea (Sweden, Am mellifera L.). Branches with a population represented from Forli (Italy, Amligustica), Berlin (Germany, Amcarnica), Chalkidiki (Greece, Amcecropia). A branch is represented populations from Johannesburg (South Africa, Amscutellata), Cape Town (South Africa, Amcapensis) and Tinznit (Morocco, Amintermissa). These results were obtained using different distances - Cavalli-Sforza and Edwards, Das, Fst. Samples from Morocco Amintermissa change their position depending on the use of different methods for assessing the genetic distances. Thus, using the standard genetic distance M. Nei (1975) Amintermissa belongs branches M, while using a minimum distance M. Nei (1975) - A branch is therefore more acceptable the result where Amintermissa belongs branches M, respectively, results morphometry F. Ruttner et al. (1978).
M.Arias c et al. (1996) in his work also showed bee subspecies division into four groups, where Group I comprises predominantly African subspecies, which can be divided into two subgroups: the northern IN (Amintermissa, Amsahariensis, Amsicula, Amiberica) and southern IS ( Amcapensis, Amadansonii, Amscutellata, Ammonticola). Although Amsicula, Amiberica not live on the African continent, they are still clustered in this group because of their common origin, which confirms the hypothesis F.Ruttner et al. (1978) about the relationship of the bees of the Iberian Peninsula and North Africa. Research A.Badino et al. (1985), L.Garnery et al. (1993) also confirm this relationship. Africanized bees in Brazil clustered with the South African group, as they are descendants Amscutellata. Amadansonii Amscutellata and come together, as by assumption M.Arias c coavt. (1996), between them there is gene flow as a result of the lack of geographical barriers. Group II consists of Amlamarckii and Ammeda. M.Arias et al. (1996) suggest that this group should unite subspecies of the Middle East and north-east Africa. Amsyriaca and Amyemenitica, may also be included in this group. Subspecies Ammellifera Amligustica and form a group III. Samples Amligustica from this group are characterized by both morphometrically Amligustica, and EcoRI restriction mtDNA haplotype shows Ammellifera. A.Badino et al., (1984) and A.Manino et al. (1984) using allozyme analysis, reported that in western Italy, there is a natural secondary contact between the subspecies and Amligustica Ammellifera. B.P.Oldroyd et al. (1992), working with the population of bees Kangaroo Island has shown that bees, morphometric and allozyme data classified as Amligustica, showed haplotype Ammellifera using EcoRI restriction mtDNA. The population of bees Kangaroo Island was formed from the bees, which were imported from Australia and Italy in the last century (Woodward, 1993, 1994, 1996). Apparently, the bees were first hybridized even in Italy. M.D.Meixner et al. described introgression populations Amligustica and Amcarnica in northeastern Italy, Slovenia and Austria morphometric and mitochondrial markers. J.M.Cornuet (1982), J.M.Cornuet et al. (1989), D.R.Smith et al. (1991) morphometric, allozyme and mtDNA RFLP data showed that in Spain there is a zone of hybridization between subspecies and Ammellifera Amintermissa. In addition, one can not ignore the role of humans in the introduction and breeding subspecies. Group IV constitute the Mediterranean subspecies: Ammacedonica, Amligustica, Amcarnica and Ammeda. Two samples Ammeda in M.Arias and W.Sheppard (1996) are located in different groups: one with African subspecies, the other from the north-Mediterranean subspecies, which confirms the hypothesis that the area of ​​its current habitat (Syria, Iran, Iraq and Turkey ) may be the center of origin of species (Ruttner, 1988; Garnery et al., 1992; Arias and Sheppard, 1996).
Subspecies of the African Group (Group I) corresponds to the proposed Ruttner et al. (1978) Group A; Northern Mediterranean subspecies group (Group IV) - Group C; and Ammellifera (Group III) - Group M. In the M.Arias and W.Sheppard (1996) Group IV Group C matches, excluding Ammeda, which by F. Ruttner (1988) belongs to A.
M. Arias et al. (1996) confirm analogy Group II Group O F.Rutter (1988). However, the similarity in appearance only, as they are different in composition. Group D contains Ammeda, but does not contain Amlamarckii. The hypothesis of relationship by descent subspecies of the Middle East and Africa, confirmed the group II, which combines Amlamarckii Ammeda from Egypt and Syria. Study additional subspecies from Turkey, the eastern Mediterranean and the Caucasus, such as Amanatoliaca and Amcaucasica will resolve the issue of kinship subspecies.
  058. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Экспериментальные исследования пчел Урала и Поволжья. Экологический мониторинг и биоразнообразие. 2009. № 4 (1-2). С. 61-62.  

Экспериментальные исследования пчел Урала и Поволжья (Experimental studies of bees of Urals and the Volga region) Самым новым и многообещающим методом генетической анализа пчел является изучение полиморфизма SNP, на основе чего можно будет составить генетический паспорт пчелы, очень быстро и дешево определить подвидовую принадлежность пчел и филогенетический паттерн. На сегодняшний день для медоносной пчелы известно несколько тысяч SNP (Whitfield et al., 2006). Изучение генетической вариабельности в популяции пчел Урала и Поволжья было выполнено нами с использованием порядка 10 генетических маркеров. Оказалось, что пчелы не по всем маркерам обладают значительным полиморфизмом. Так микросателлитный локус ар049 в популяции пчел Башкортостана обладал очень незначительным полиморфизмом и в дальнейшем не был использован. Значительным полиморфизмом обладали микросателлитные локусы - ар243, 4al 10, А8, А113 ядерной ДНК. Очень интересный полиморфизм наблюдался у меж- генного локуса COI-COII мтДНК, где мы обнаружили существование 4 гаплотипов (Q, PQ, PQQ и PQQQ). Кроме того, в популяции пчел Урала и Поволжья полиморфным является ген антибактериального пептида дефензина (Львов, 2002) ядерной ДНК. Оказалось, что для большинства популяций пчел, где не происходит массовый ввоз семей, наблюдается некоторая доля инбридинга, тогда как в популяциях, в которые завозят пчел извне, наблюдается аутбридинг. The newest and most promising method Genetic analysis is the study of bees polymorphism SNP, on the basis of which can be make genetic passport bees, very quickly and cheaply identify subspecies bees and phylogenetic pattern. To date, for the honeybee several thousand known SNP (Whitfield et al., 2006). The study of genetic variability in bee population of the Urals and the Volga region was carried out us with the order of 10 genetic markers. It was found that the bees not all markers have significant polymorphism. So microsatellite loci ar049 in the population of bees Bashkortostan had a very slight polymorphism and subsequently was not used. considerable polymorphism had microsatellite loci - Ar243, 4al 10, A8, A113 nuclear DNA. very Much interesting polymorphism observed in inter- gene locus COI-COII mtDNA where we found the existence of four haplotypes (Q, PQ, PQQ and PQQQ). Furthermore, in the bee population Urals and the Volga is a polymorphic gene defensin antimicrobial peptides (Lviv, 2002) of nuclear DNA. It turned out that for most bee populations where there is no mass import families, there is some share of inbreeding, whereas in populations in which bees are imported from outside, there is outbreeding. Publication Name: Ilyasov RA, Poskryakov AV, Nikolenko AG Experimental studies of bees of Urals and the Volga region. Environmental monitoring and biodiversity. 2009. V. 4 (1-2). P. 61-62.
  059. Ильясов Р.А., Шареева З.В., Поскряков А.В., Николенко А.Г. Сравнительный анализ нуклеотидной последовательности фрагмента гена ND2 мтДНК в популяциях пчел республики Башкортостан. Вестник Оренбургского государственного университета. 2009. № 6 (100). С. 155-156.  

Сравнительный анализ нуклеотидной последовательности фрагмента гена ND2 мтДНК в популяциях пчел республики Башкортостан (Comparative analysis of the nucleotide sequence of the gene fragment ND2 of mtDNA in populations of bees of the republic of Bashkortostan)
В статье приводятся результаты сравнительного анализа нуклеотидной последовательности фрагмента гена ND2 мтДНК пчел Бирского района и пчел A.m.mellifera и A.m.caucasica. Кластерный анализ показал большее сходство пчел бирской популяции с A.m.mellifera, чем с A.m.caucasica.
The article presents the results of a comparative analysis of the nucleotide sequence of the gene fragment of mtDNA ND2 bees and bees Birsky District Ammellifera and Amcaucasica. Cluster analysis showed greater similarity with the populations of bees Birsk Ammellifera, than Amcaucasica.
Publication Name: Ilyasov R.A., Shareeva ZV, Poskryakov A.V. Nikolenko A.G. Comparative analysis of the nucleotide sequence of the gene fragment ND2 of mtDNA in populations of bees of the republic of Bashkortostan. Bulletin of the Orenburg State University. 2009. V. 6 (100). P. 155-156.
  060. Шареева З.В., Ильясов Р.А., Кутлин Н.Г., Поскряков А.В., Николенко А.Г. Изучение генетической структуры северной части ареала башкирской популяции Apis mellifera mellifera L. Вестник Оренбургского государственного университета. 2009. № 6 (100). С. 427-428.

Изучение генетической структуры северной части ареала башкирской популяции Apis mellifera mellifera L. (The study of the genetic structure of the northern part of the area of the Bashkir population of Apis mellifera mellifera L.)
Нами был изучен уровень генетического разнообразия северной части ареала башкирской популяции A.m.mellifera на основе F-коэффициентов и гетерозиготности, рассчитанных по данным частот аллелей и генотипов микросателлитных локусов ap243, 4a110 и А8 ядерной ДНК.
We have studied the level of genetic diversity northern part of the area of the Bashkir population Ammellifera based on F-ratio and heterozygosity calculated according to the allele and genotype frequencies of microsatellite loci ap243, 4a110 A8 and nuclear DNA.
Publication Name: Shareeva ZV, Ilyasov R.A., Kutlin NG, Poskryakov A.V. Nikolenko A.G. The study of the genetic structure of the northern part of the area of the Bashkir population of Apis mellifera mellifera L. Bulletin of the Orenburg State University. 2009. V. 6 (100). P. 427-428.
  061. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Population genetics analysis of bees from populations of Ural and Volga regions. Materials of IV international conference of young scientists “Biodiversity. ecology. adaptation. evolution”. Odessa. 2009. C. 99-100.  

In Bashkortostan republic there is very hard problem of conservations of aboriginal bee subspecies A.m.mellifera. For conservations it is necessary identification  hybrid families, to eliminate their further distribution. Intergenic locus COI-COII of mtDNA varying among bees subspecies. There are the genetic markers of this locus allowing identify of hybrid origin bees colonies, in particular hybridization with bees from Caucasus (A.m.caucasica and A.m.armeniaca). In Bashkortostan republic we shown existence pool of the saved aboriginal bees in the north of republic on territory of several districts (Тatyshlynski, Birski, Кaraidelski, Мishkinski, Buraevski and Аskinski) and in the south of republic on territory of Burzyan district.
 We studied populations of bees on territory of several regions of Ural and Volga region. Large populations of bees A.m.mellifera on our researches was saved on territory of Permski oblast, Bashkortostan republic and republic Udmurtiya. The higher degree of hybridization is observed in bee population on territory of the Chelyabynski and Sverdlovski oblast. On the basis of the conducted researches it is already possible to make the map of geographical distribution of natural area of aboriginal bee A.m.mellifera.
 Genetic relatedness of A.m.mellifera populations we show using nuclear DNA locuses, in particular microsatellites ap243, 4a110, ap049, a113, a43, a8. On the grouping of population influences both community of their origin and their geographical location in relation to each other. Cluster analysis was conducted using neighbour joining method. On built dendrogram Bee population of Iglinski district grouping separately from other populations of Bashkortostan republic. On dendrogram bee populations of different regions (Bashkortostan republic, Permski oblast, republic Udmurtiya and Sverdlovskaya oblast) population of bees of Sverdlovskaya oblast is disposed separately. Such separate location of bees population of Iglinski district of Bashkortostan republic and Sverdlovskaya oblast is explained by their hybrid origin. Our laboratory plans to extend genetic researches of bees populations on territory of Russia and also  countries of CIS.
  062. Fahretdinova S.A., Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Prospects of wild bee populations preservation of burzyan districts in bashkortostan apis mellifera mellifera L. Materials of IV international conference of young scientists “Biodiversity. ecology. adaptation. evolution”. Odessa. 2009. C. 96.  

The area of a honeybee of subspecies Apts mellifera mdlijera L ( A bee of Middle Russian race) distribution covered extensive territory from the Britain to the Urals, along the northern border of the distribution of this species. Evolution of this subspecies took place in severe environmental conditions and as a result il has got the properties which have provided advantages over other subspecies. Throughout the XX-th century the area of Apis mellifera mellifera subspecies reduced as a result of hybridization with ofher subspecies. Several populations of Apis melufem mellifera are known in the Urals. In Bashkiria it is northern and southern (burzjanski) populations. Burzjan population is unique because it is rather large in size, it is highly isolated and is less subjected to anthropogenous influences.
Besides, cultivation of wild bees in Burzjansky area is preserved Bees population from apiaries plays a great role in wild bees preservation. There is constant exchange Between wild bees and bees from apiaries Population ot wild bees replenishes at the expense of bees from apiaries.
The example of South Ural forest reserve demonstrated that the оi.-.appearance of villages was followed bv wild bees. Therefore, to guarantee preservation of wild bees population, it is necessary to study genetic processes not only on the territory of forest reserve ^Shulgan-Tash» (where all the researches were mainly carried out). It is very important to investigate the population of the wnole this area.
  063. Шареева З.В., Ильясов Р.А., Кутлин Н.Г., Поскряков А.В., Николенко А.Г. Пчела подвида Apis mellifera mellifera L. на Cевере республики Башкортостан // Ученые записки Казанской государственной академии ветеринарной медицины им. Н. Э. Баумана. Серия. Естественные науки. 2008. Т. 195. С. 245-249.

Проблема гибридизации темной лесной пчелы с южными подвидами и сохранение генофонда среднерусских пчел Apis mellifera mellifera L. является основной в развитии пчеловодства России уже более полувека. В настоящее время для их решения применяются как классические (анализ фенотипических признаков – экстерьерные, морфологические, хозяйственно-полезные, поведенческие) (надо все убрать, т.к. уже есть в начале), так и современные молекулярно-генетические методы идентификации расовой принадлежности медоносных пчел, что значительно повысило эффективность анализов при высоком количестве гибридных семей. Исследуемые нами районы также попали под массовый эксперимент по гибридизации, который преследовал цель – улучшение хо-зяйственнополезных  признаков местных пчел. Полученные нами результаты позволяют утверждать , что в данных популяциях произошел процесс самовосстановления исходного генофонда, что в свою очередь свидетельствует о большей приспособленности к местным условиям (надо заменить на следствием чего является высокий уровень приспособленности к местным условиям Южного Урала). Мы предполагаем, что процесс восстановления аборигенного генофонда мог произойти благодаря комплексному воздействию факторов окружающей среды, таких как природно-климатические, антропогенные, биогеоценотические и др. Естественно, что восстановление не могло бы произойти в случае, если генофонд местных пчел был бы полностью уничтожен. В данном случае произошел клас-сический процесс борьбы за существование, результатом чего стало вытеснение наименее приспособленных генотипов. Следует отметить, что генофонд современных пчел этого региона не остался прежним, а подвергся некоторым модификациям, существенно не влияющим на об-щий уровень приспособленности.
Выводы и предложения
Таким образом, выдвинутая нами гипотеза о возможном более ши-роком распространении ареала популяции Apis mellifera mellifera L. подтвердилась высокими результатами частоты (надо заменить на по результатам частоты) встречаемости комбинации PQQ у пчел исследуемых районов. Поскольку с момента повсеместной гибридизации прошло уже более полувека (надо заменить на более пятидесяти лет), очевидно, изучаемые нами популяции пчел восстановили свой исходный генофонд.
В настоящее время нами проводятся сравнительные популяционно-генетические исследования на основе полиморфизма микросателлитных локусов ядерного генома пчел. Мы предполагаем, что сходные результаты можно получить и по популяциям пчел других северных районов Республики Башкортостан, что может явиться целью наших дальнейших исследований.
The problem hybridization dark forest bees with the southern subspecies and preserve the gene pool of the Central Russian bee Apis mellifera mellifera L. is the main development of beekeeping Russia for more than half a century. Currently, their solutions are used both classic (analysis of phenotypic traits - exterior, morphological, economically useful, behavioral) (everything must be clean, as is already in the beginning) and modern molecular genetic methods for identification of race honey bees, which greatly increased the efficiency of analyzes with high number of hybrid families. We investigated areas also came under a massive experiment on hybridization, which was aimed at - improving ho zyaystvennopoleznyh signs of local bees. Our results suggest (should be changed to assume) that occurred in these populations of the recovery process (it is necessary to put the renewal of the) of the original gene pool, which in turn indicates a greater adaptability to local conditions (to be replaced by resulting in a higher level of fitness to the local conditions of the Southern Urals). We assume that the process of restoring native gene pool could occur due to the combined effect of environmental factors, such as climatic, anthropogenic, biogeocenotic and others. Of course, that recovery might not happen if the gene pool of native bees would have been completely destroyed. In this case, there was a class-rescattering of the process of the struggle for existence, which resulted in the ousting of the least adapted genotypes. It should be noted that the gene pool of modern bees in this region has not remained the same, but has undergone some modifications do not affect the overall level of fitness,.
Conclusions and suggestions
Thus, we put forward the hypothesis of a possible dissemination of the SI-rock area populations Apis mellifera mellifera L. results confirmed the high frequency (to be replaced by the results of the frequency) of occurrence of the combination of PQQ bees studied areas. Because since the widespread hybridization has been more than half a century (to be replaced by more than fifty years), it is obvious we are studying bee population regained its original gene pool.
Currently, we carry out a comparative population genetic studies based on polymorphism of microsatellite loci of the nuclear genome of bees. We believe that similar results can be obtained on populations of bees other northern areas of the Republic of Bashkortostan, which may be the aim of our further research. 
  064. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Investigations of population Apis mellifera mellifera L. from Burzyan district of Bashkortostan on Southern Urals. Materials of international conference "XLVI Naukowa konferencja pszczelarska". Pulawy. 2009. P. 41-42.

Our earlier researches was shown that bashkir bees (bees from Bashkortostan republic of Russia) on taxonomy behaved to the subspecies of A.m.mellifera. Originally one unique place where conservation clean strains of this bee considered a small region on the south of Bashkortostan in national park “Shulgan-Tash”. The task of our research is the study bees population on south part of natural area of bashkir bees.
Bees were selected from 5 places: village Starosubkhangulovo, village Novomusyatovo, village Irgyzly of Burzyanskii district, village Krutoi log of Аbzelylovskii district, village Syuren Кugarchynskii district of Bashkortostan. In research were used: locus COI-COII mtDNA, 4 microsatellite locuses ap243, 4a110, a8, a43 of nuclear DNA. We calculated frequencies of alleles of every locuses. Frequencies of combination PQQ (marker of A.m.mellifera) of intergenic locus COI-COII mtDNA in all bees populations were with frequency 1.0, while in Syuren there haven’t it. For receiption of information about distributing of southern bashkir bee population is necessary to get frequencies of all alleles and genetic distances between local populations.
Maximal distances is observed between populations Syuren and Krutoi log. Minimal distances – between populations Krutoi log and Novomusyatovo. Such grouping agreed both geographical location and genetic composition of these population. In cluster analysis by neighbour joining method population of Syuren disposed apart from all because hybrid colonies of bees are represented here mainly. Picture of cluster analysis can reflect some degrees the levels of migrations between populations where most close located population will be closely-related genetically also. Thus, our conducted researches allow to make conclusion that natural area of Burzyan population (bees population in Burzyanskii district) of bashkir bees A.m.mellifera, possibly has expansion to east direction to Аbzelylovskii district, while to a south to Кugarchynskii district it hasn’t expansion.
  065. Kolbina L.M., Nepeivoda S.N., Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Comparing the methods of race determination bee-colonies under global crossbreeding of bees. Materials of international conference "XLVI Naukowa konferencja pszczelarska". Pulawy. 2009. P. 37-38.

In our research the sample of 63 bee-families of 11 apiaries of 6 regions of Udmurtia Repablic was used. In this research we used morphometric and genetic methods. Genetic research was carried out in common with institute of biochemistry and genetics of Ufa scientific center Russian Academy of Sciences. The basis of genetic analysis was the polymorphism of intergenic locus COI-COII of different races of bees (table 1).
The results of both methods coincided more than by 66% in Mozhginskiy region, in diametrical opposition with Sharkanskiy region. This allows to choose confidently only the one population of A.m. silvanium that habits in Mozhginskiy region, all other bees were strongly crossbreeded.
Besides all its advantages, genetic method has serious weakness. The native race of the bees of Udmurtia Republic is Apis mellifera mellifera, and brought bee-families of other races were the small part in general bees of Udmurtia Republic. In result the most part of crossbreeding of bee-families was from the male line, which genetic method can not consider. On other hand, high variability of morphological characteristics, that appear as results of global crossbreeding, leaded to the effect that some of hybrid bee-families have figure of A.m. mellifera race. Therefore, reliable results can be obtained only by using both morphological and genetic methods of analysis.
  066. Колбина Л.М., Непейвода С.Н., Ильясов Р.А., Николенко А.Г., Поскряков А.В. Генетический анализ популяции пчел Западного Предуралья и Республики Башкортостан. Материалы Международной научно-практической конференции "Зоотехническая наука на удмуртской земле. Состояние и перспективы". Ижевск. 2009. С.49-55.  

Рассмотрены две популяции пчёл Западного Предуралья и Республики Башкортостан. По результатам анализа ядерной и митохондриальной ДНК на территории Западного Предуралья распространена генетически подразделенная популяция пчёл среднерусской породы, частично гибридизированная с подвидами из южных регионов. Проведен сравнительный анализ популяций пчел Западного Предуралья с популяцией пчел среднерусской расы A.m.mellifera Бурзянского района и гибридной популяцией Иглинского района Республики Башкортостан. В исследованиях использовался анализ межгенного локуса COI-COII мтДНК и микросателлитный локус 4а110 яДНК. По результатам исследований выявлены частоты встречаемости двух видов аллелей микросателлитного локуса 4а110 ядерной ДНК и межгенного локуса COI-COII митохондриальной ДНК. Исходя из вышеприведенной частоты, легко вычислить ожидаемую встречаемость генотипов микросателлитного локуса 4а110 ядерной ДНК при условии случайного смешивания. Однако исследования показали, что реальная картина частот встречаемости генотипов отличается от ожидаемой. В некоторых случаях очень значительно, особенно у Глазовской и Камбарской популяций. В то же время частота встречаемости генотипов Шарканской популяции практически соответствует ожидаемой. Частота встречаемости генотипов межгенного локуса COI-COII митохондриальной ДНК равна частоте встречаемости аллелей. Для любого локуса генетическое разнообразие является вероятностью того, что две аллели, случайным образом выбранных в популяции, будут отличаться друг от друга. Если генное разнообразие микросателлитного локуса 4а110 ядерной ДНК большое у всех изученных популяций, то генное разнообразие межгенного локуса COI-COII митохондриальной ДНК в большинстве случаев невысоко, в нем лидирует Бурзянская популяция, чуть меньшее разнообразие в Шарканской и Завьяловской популяции, а в Глазовской и Мож- гинской популяции все изученные образцы по межгенному локусу COI-COII митохондриальной ДНК принадлежат к одному генотипу. В дальнейшем были рассчитаны коэффициенты генетической дифференциации Fst для уральских популяций совместно по анализу микросателлитного локуса 4а110 ядерной ДНК и межгенного локуса COI-COII митохондриальной ДНК. Значение коэффициента дифференциации Fst колеблется от 0,011 до 0,422, что в большинстве случаев позволяет утверждать о наличии статистически значимой дифференциации популяций пчел. Генетические расстояния, рассчитанные с помощью анализа частот аллелей межгенного локуса COI-COII митохондриальной ДНК, были в пределах от 0,000 до 0,966. В отличие от результатов, полученных с помощью изучения микросателлитного локуса 4а110 ядерной ДНК, эти данные говорят о гораздо большей дистанции между популяциями пчел. Особенно далеко отстоит от других Завьяловская популяция, пределы генетических расстояний между ней и остальными популяциями колеблются в пределах от 0,133 до 1,151, что демонстрирует очень значительные различия в происхождении этих популяций. При графическом отображении генетической дифференциации популяций на основе полученных генетических расстояний (D) Nei микросателлитного локуса 4а110 ядерной ДНК легко заметить, что Глазовская популяция наиболее удалена от других популяций, тогда как между остальными не обнаружено статистически значимой генетической дифференциации. При графическом отображении генетической дифференциации популяций на основе полученных генетических расстояний (D) Nei межгенного локуса COI-COI1 митохондриальной ДНК наблюдается принципиально иная картина. Четко обособлена от остальных популяций пчел Завьяловская. Кроме того, выделяются две четкие группы популяций, в одну входят Иглинская и Шарканская популяции, а во вторую Бурзянская, Камбарская, Мало-Пургинская, Глазовская и Можгинская популяции. Внутри двух выделенных групп популяций не удалось обнаружить статистически значимую генетическую дифференциацию. При графическом отображении генетической дифференциации популяций на основе совместного анализа генетических расстояний (D) Nei как икросателлитного локуса 4аП0 ядерной ДНК, так и межг енного локуса COI-COII митохондриальной ДНК наблюдается картина, схожая с предыдущей. Четко обособлена Завьяловская популяция пчел, остальные популяции разделяются на две достоверно отличающиеся друг от друга группы, внутри которых не наблюдается статистически значимой генетической дифференциации. Таким образом, по результатам анализа ядерной и митохондриальной ДНК на территории Западного Предуралья наблюдается генетически подразделенная популяция пчел среднерусской расы, частично гибридизированная с подвидами из южных регионов. Очень небольшой объем выборки позволяет делать только предварительные выводы.
We examined two populations of bees and of the West Urals Bashkortostan. According to the analysis of nuclear and mitochondrial DNA in the West Urals common genetic subdivision Central Russian breed of bees population, partly hybridized a subspecies of the southern regions. A comparative analysis of bee populations West Ural region with a population of bees of Central race Ammellifera Burzyansky district and hybrid populations iglinsky district Republic of Bashkortostan. The study used the analysis of intergenic locus COI-COII mtDNA and nuclear DNA microsatellite loci 4a110. According to the research revealed the frequency of occurrence two kinds of alleles of microsatellite loci 4a110 nuclear DNA intergenic locus COI-COII mitochondrial DNA. Based on the above frequency, it is easy to calculate the expected genotypes of microsatellite loci 4a110 Nuclear DNA provided accidental mixing. However, studies have shown that the real picture of the frequency of occurrence of genotypes It is different from the expected. In some cases, very significant, especially in the Glazov and Kambarka populations. In the same time frequency of genotypes Sharkan population almost It corresponds to the expected. The frequency of genotypes intergenic locus COI-COII equal to the frequency of mitochondrial DNA alleles. For each locus, genetic diversity is likely that the two alleles in a randomly selected population will differ from each other. If genetic diversity microsatellite loci 4a110 nuclear DNA in all large populations studied, the genetic diversity intergenic locus COI-COII mtDNA in most cases, is low, it leads Burzyan population slightly smaller variety in Sharkan and Zavyalovsky population, and in the Glazov and one can ginskiT population of all the studied samples of intergenic locus COI-COII mitochondrial DNA belong to the same genotype. In the future, genetic factors were calculated Fst differentiation for the Ural population together Analysis microsatellite loci 4a110 nuclear DNA and the intergenic locus COI-COII mitochondrial DNA. The coefficient Fst differentiation ranges from 0.011 to 0.422, in most cases, suggests the presence of a statistically significant differentiation of bee populations. Genetic distances calculated using frequency analysis alleles intergenic locus COI-COII mitochondrial DNA, They ranged from 0.000 to 0.966. In contrast to the results obtained by studying nuclear microsatellite loci 4a110 DNA, these data suggest a much greater distance between populations bees. Especially far from other Zavyalovsky population, limits genetic distances between it and the rest populations ranged from 0.133 to 1.151, which demonstrates very significant differences in the origin of these populations. In the graphical display of genetic differentiation population based on genetic distances obtained (D) Nei microsatellite loci 4a110 nuclear DNA is easy to see that Glazovskaya population is furthest from the other populations, then both among the other found no statistically significant genetic differentiation. In the graphical display of genetic differentiation population based on genetic distances obtained (D) Nei intergenic locus COI-COI1 mitochondrial DNA is observed radically different picture. Clearly separated from the rest of the population Zavyalovsky bees. Furthermore, it identifies two distinct groups populations, one includes Iglinskiy and Sharkan population and the second Burzyan, Kambarka, Little Purginskaya, Glazovskaya and Mozhginsky population. Within two selected population groups could not find a statistically significant genetic differentiation. In the graphical display of genetic differentiation populations on the basis of a joint analysis of genetic distances (D) Nei like ikrosatellitnogo locus 4aP0 nuclear DNA and the inter-tary locus COI-COII mitochondrial DNA is observed picture, similar to the previous one. Clearly separated Zavyalovsky population bees, other populations are divided into two significantly different from each other group, which is not observed in statistically significant genetic differentiation. Thus, according to the analysis of nuclear and mitochondrial DNA in the West Urals been genetically subdivided population of bees of Central race, partly hybridized with a subspecies of the southern regions. Highly small sample size allows only preliminary findings.
  067. Ильясов Р.А., Николенко А.Г., Поскряков А.В. Новые представления о филогенетике пчелы вида Apis mellifera L. Материалы Международной научно-практической конференции "Экология, эволюция и систематика животных". Рязань. 2009. С. 315-316.  

В работе были использованы пчелы подвида A.m.mellifera из бурзянской и татышлинской популяций Республики Башкортостан и вишерской и южно-прикамской популяций Пермского края, которые были ранее выделены нами на основе изучения полиморфизма межгенного локуса COI-COII мтДНК (Ильясов с соавт., 2006). Также были использованы пчелы из украинской популяции с пасеки А.Д.Комиссара под Киевом. Для проведения секвенционного анализа было взято по три образца из каждой популяции.
При сравнении нуклеотидной последовательности фрагмента гена ND2 мтДНК уральских и украинских пчел с последовательностью бурзянской бортевой пчелы (DQ181611), взятой в качестве референсной, всего наблюдались нуклеотидные замены в 12 позициях. Между всеми уральскими пчелами наблюдалось 5 сайтов замен, где замена в позиции 536 Т на С в двух пчелах DQ181614 и DQ181618 приводила к замене в позиции 12 аминокислотной последовательности Ile на Thr. Украинские пчелы различались от референсной последовательности сайтами замен в 8 позициях, где замена в позиции 987 являлась трансверсией. Между собой украинские пчелы практически не различались – наблюдалась всего одна замена нуклеотидной последовательности фрагмента гена ND2 мтДНК в позиции 1099, которая не приводит к заменам в аминокислотной последовательности.
На основе сравнительного анализа нуклеотидной последовательности фрагмента гена ND2 мтДНК пчел популяций A.m.mellifera на Урале с использованием компьютерной программы MEGA 3.1 методом кластеризации ближайшего соседа была построена дендрограмма. На дендрограмме наблюдался низкий уровень дифференциации представителей разных популяций A.m.mellifera на Урале. Однако можно отметить, что все три представителя вишерской популяции (DQ181617-19), а также один представитель южно-прикамской популяции (DQ181621) все же в некоторой степени отличаются от всех представителей других популяций Урала, хотя эти различия очень незначительны. Такие различия представителей вишерской популяции, возможно, являются результатом длительной изоляции в условиях крайнего севера видового ареала. Известно, что семьи пчелы из этой популяции  неоднократно завозились на пасеки юга Пермского края, что и, возможно, объясняло группировку вместе с пчелами вишерской популяции представителя южно-прикамской популяции (DQ181621). Большие различия наблюдались между представителями уральских и украинских популяций, что обусловлено, несомненно, их принадлежность к разным подвидам - A.m.mellifera и A.m.macedonica, соответственно.
Для определения филогенетического паттерна вида A.mellifera и выявления положение в нем уральских и украинских пчел было проведено сравнение нуклеотидной последовательности фрагмента гена ND2 мтДНК просеквенированных нами пчел с последовательностями пчел разных других подвидов A.mellifera, просеквенированных M.C.Arias, W.S.Sheppard (1996), W.S.Sheppard, M.D.Meixner (2003). Нуклеотидная последовательность фрагмента гена ND2 мтДНК подвида пчелы A.m.anatoliaca была взята в качестве референсной последовательности и использована для сравнения с последовательностями всех образцов пчел. При сравнении секвенсов всех образцов пчел наблюдались нуклеотидные замены в 28 позициях. Из всех замен 8 относились к трансверсиям, а 20 – к транзициям, что вполне укладывалось в рамки законов молекулярной эволюции.
На основе сравнения нуклеотидных последовательностей с использованием программы MEGA 3.1 и метода кластеризации ближайшего соседа была построена дендрограмма генетических отношений подвидов A.mellifera с видами Apis cerana и Mellipona bicolor, где последние были взяты в качестве внешней группы. На дендрограмме наблюдалась группировка образцов пчел на четыре эволюционные ветви, что не противоречило результатам F.Ruttner (1988). Однако состав этих ветвей отличался от представленного F.Ruttner (1988) и был в некоторой степени схож с представленными в работе M.C.Arias, W.S.Sheppard (1996). Однако четыре эволюционные ветви были все же названы A, M, C и O сходно с F.Ruttner (1988).
Эволюционная ветвь А объединяла большинство представителей африканских подвидов пчел. Эта эволюционная ветвь подразделялась на две группы, одна из которых объединяла A.m.sahariensis (U35762) и A.m.inermissa (U35751) из Марокко, A.m.sicula (U35765) с Сицилии и A.m.iberica (U35750) из Португалии. Другая группа объединяла большинство южно-африканских подвидов пчел как A.m.adansonii из Нигерии (U35743), A.m.scutellata (U35764) и A.m.capensis (U35747) из ЮАР, A.m.monticola (U35761) из Кении и африканизированных пчел из Бразилии (U35745-46). Кроме того, выделялась еще одна небольшая третья группа африканских пчел, объединяющая представителей подвидов A.m.scutellata (U35763) из Кении и A.m.adansonii (U35744) из Сенегала, то есть на территории, огибающей пустыню Сахара.
Эволюционная ветвь О была очень малочисленной и объединяла представителей подвидов A.m.meda (U35756) и A.m.syriaca (AY618920) из Сирии и A.m.lamarckii (U35753) из Египта.
Эволюционная ветвь М объединяла в основном всех представителей A.m.mellifera уральских (DQ181611-22) и европейских популяций из Швейцарии (AY114495), Франции (U35758), Испании (U35759) и Норвегии (U35760). Однако в эту группу также вошли по два представителя подвидов A.m.sicula (AY114493-94) с Сицилии и A.m.ligustica (U35752 и AY114490) из Италии, которые попали в эту группу, возможно, благодаря первоначальной гибридизации с завезенными туда A.m.mellifera. По нашим данным только A.m.mellifera является единственным представителем эволюционной ветви М.
Эволюционная ветвь С была наиболее многочисленной как по числу подвидов, так и по числу образцов и объединяла подвиды пчел Средиземноморья, Ближнего Востока и Кавказа - A.m.ligustica  из Италии, A.m.carnica из Германии, Австрии и Словении, образцы A.m.macedonica из Греции и Украины с пасеки А.Д.Комиссара проанализированные нами, A.m.cecropia из Греции, A.m.sicula с Сицилии, A.m.cypria с Кипра, A.m.adami с Крита, A.m.caucasica с Кавказа, A.m.meda из Сирии, A.m.anatoliaca из Турции, A.m.syriaca из Сирии и A.m.pomonella с Тянь-Шаня. Однако по составу подвидов этой эволюционной ветви наблюдались различия с F.Ruttner et al. (1988), которые относили подвиды A.m.caucasica, A.m.adami, A.m.cypria, A.m.meda, A.m.anatoliaca и A.m.syriaca к эволюционной ветви О.
Проведенное исследование показало генетическое родство уральских и западноевропейских популяций A.m.mellifera. Возможно, что подвид A.m.mellifera является единственным представителем внутривидовой эволюционной ветви М, в которую, таким образом, не следует включать не только африканские подвиды Apis mellifera sahariensis и Apis mellifera intermissa, но и испанский подвид Apis mellifera iberica, что противоречит гипотезе F.Ruttner (1988). Показано, что предковой формой вида Apis mellifera L., могли быть пчелы эволюционной ветви С, а не О, как считал ранее F.Ruttner (1988). Результаты анализа украинских пчел, подтвердили их принадлежность к подвиду A.m.macedonica. Было подтверждено, что подвиды A.mellifera подразделяются на 4 эволюционные ветви, а не 3, как считали ранее.
We used bee subspecies of Ammellifera Burzyan tatyshlinskoy populations and the Republic of Bashkortostan and Visherskaya Kama region and southern populations of the Perm region, which had previously been allocated on the basis of our study of polymorphism of the intergenic locus COI-COII mtDNA (Ilyasov et al., 2006). Bees were also used from the Ukrainian population from the apiary A.D.Komissara near Kiev. To perform the analysis were taken sekventsionnogo Three samples of each population.
When comparing the nucleotide sequence of the gene fragment ND2 mtDNA Ural and Ukrainian bees sequence Burzyan wild-hive bee (DQ181611), taken as a reference, the entire nucleotide substitutions were observed at 12 positions. Between all the Ural bees observed 5 sites replacements where the replacement at position 536 T to C in two bees DQ181614 and DQ181618 leads to the substitution at position 12 in the amino acid sequence Ile Thr. Ukrainian bees differ from the reference sequence sites substitutions in 8 positions where substitution at position 987 was transversions. Between a Ukrainian bees practically identical - there was only one replacement of the nucleotide sequence of a gene fragment ND2 mtDNA positions in 1099, which does not lead to substitutions in the amino acid sequence.
On the basis of a comparative analysis of the nucleotide sequence of a gene fragment ND2 mtDNA bee populations in the Urals Ammellifera using a computer program MEGA 3.1 by nearest neighbor clustering dendrogram was constructed. In the dendrogram observed low level of differentiation of representatives of different populations Ammellifera the Urals. However, it should be noted that all three members of the population Visherskaya (DQ181617-19), as well as one representative of the population of South-Kama region (DQ181621) is still somewhat different from all other representatives of the Urals populations, although these differences are very minor. Such differences representatives Visherskaya populations are probably a result of long-term isolation in the Far North of the species range. It is known that the family of bees this population often imported apiary on the south of the Perm region, and that may explain the grouping together with bees Visherskaya population representative of the population of the South-Kama region (DQ181621). Large differences were observed between the Ural and Ukrainian population, due, no doubt, they belong to different subspecies - Ammellifera and Ammacedonica, respectively.
To determine the phylogenetic species A.mellifera pattern and identify its position in the Ural and Ukrainian bees were compared the nucleotide sequence of the gene fragment sequenced mtDNA ND2 our bees with different sequences of other subspecies of bees A.mellifera, sequenced MCArias, WSSheppard (1996), WS Sheppard, MDMeixner (2003). The nucleotide sequence of a gene fragment ND2 mtDNA bee subspecies Amanatoliaca was taken as a reference sequence, and used for comparison with the sequences of all the samples of bees. When comparing all samples Sequence bees observed nucleotide substitutions in 28 positions. Of the 8 substitutions treated transversions and 20 - to the transitions that fits into the framework of the laws of molecular evolution.
Based on a comparison of the nucleotide sequences using the program MEGA 3.1 and the nearest neighbor clustering method was constructed dendrogram of genetic relationship subspecies A.mellifera overlooking Apis cerana and Mellipona bicolor, where the latter have been taken as an outgroup. In the observed dendrogram grouping samples of bees into four evolutionary branch that does not contradict the results of F.Ruttner (1988). However, the composition of these branches differ from the F.Ruttner (1988) and was somewhat similar to that shown in MCArias, WSSheppard (1996). However, four evolutionary branches were still named A, M, C and O is similar to F.Ruttner (1988).
Evolutionary branch A united the majority of the African subspecies of bees. This evolutionary branch was divided into two groups, one of which is united Amsahariensis (U35762) and Aminermissa (U35751) from Morocco, Amsicula (U35765) with Sicily and Amiberica (U35750) from Portugal. Another group unites the majority of the South African subspecies of bees as a Amadansonii Nigeria (U35743), Amscutellata (U35764) and Amcapensis (U35747) from South Africa, Ammonticola (U35761) from Kenya and Africanized bees in Brazil (U35745-46). Furthermore, stood another small third group of African bees, uniting representatives of subspecies Amscutellata (U35763) from Kenya and Amadansonii (U35744) from Senegal, that is the territory of the envelope Sahara Desert.
On the evolutionary branch it is very small and has united representatives of subspecies Ammeda (U35756) and Amsyriaca (AY618920) from Syria and Amlamarckii (U35753) from Egypt.
The evolutionary branch of M united mainly of representatives of the Ural Ammellifera (DQ181611-22) and European populations from Switzerland (AY114495), France (U35758), Spain (U35759) and Norway (U35760). However, this group also includes two representatives subspecies Amsicula (AY114493-94) from Sicily and Amligustica (U35752 and AY114490) from Italy, who are in this group, probably due to the initial hybridization with importations to Ammellifera. According to our data only Ammellifera the sole representative of the lineage M.
With evolutionary branch was the most numerous in both the number of subspecies, and the number of samples and bee subspecies united Mediterranean, the Middle East and the Caucasus - Amligustica from Italy, Amcarnica from Germany, Austria and Slovenia, Ammacedonica samples from Greece and Ukraine in the apiary A.D.Komissara analyzed by us, Amcecropia from Greece, Amsicula from Sicily, Amcypria Cyprus, Amadami Crete, Amcaucasica the Caucasus, Ammeda Syria, Amanatoliaca from Turkey, Amsyriaca from Syria and Ampomonella with the Tien Shan. However, the composition of the sub-species evolutionary branch observed differences F.Ruttner et al. (1988), which refers subspecies Amcaucasica, Amadami, Amcypria, Ammeda, Amanatoliaca and Amsyriaca to evolutionary branch O.
The study showed the genetic relationship of the Urals and Western European populations Ammellifera. Perhaps Ammellifera subspecies is the only representative of intraspecific evolutionary branches M, which thus should not be included not only African subspecies Apis mellifera sahariensis and Apis mellifera intermissa, but Spanish subspecies Apis mellifera iberica, which contradicts the hypothesis F.Ruttner ( 1988). It is shown that the ancestral form of the type Apis mellifera L., could be evolutionary branch with bees, and not, as previously thought F.Ruttner (1988). The results of the analysis of Ukrainian bees, have confirmed that they belong to the subspecies Ammacedonica. It was confirmed that the subspecies A.mellifera divided into 4 evolutionary branches, not 3, as previously thought.
  068. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Генетическая характеристика локальной популяции пчел Альшеевского района Республики Башкортостан. Материалы Международной научно-практической конференции и Х зоологической конференции "Проблемы сохранения биологического разнообразия и использования биологических ресурсов". Минск. 2009. Ч. 1. С. 127-130.  

В работе были взяты локальные популяции пчел трех пасек Альшеевского района республики Башкортостан, локальная популяция пчел пасеки Красновишерского района Пермского края, ранее определенная как популяция A.m.mellifera по результатам анализа локуса COI-COII мтДНК и двух микросателлитных локусов ap243 и 4a110 (Ильясов с соавт., 2006), и локальная популяция пчел пасеки Красноуфимского района Свердловской области, ранее определенная как популяция гибридного происхождения по результатам анализа локуса COI-COII мтДНК (Ильясов с соавт., 2008).
На основе анализа полиморфизма локуса COI-COII мтДНК и микросателлитных локусов ap243, 4a110, a24, a8, a43, a113, ap049 яДНК были рассчитаны генетические расстояния Nei между локальными популяциями. Генетические расстояния были рассчитаны отдельно по микросателлитным локусам и отдельно с использованием локусов ядерной и митохондриальной ДНК. Генетические расстояния были рассчитаны как для каждой пасеки отдельно, так и для локальной популяции района, включающей все пасеки района. Генетические расстояния были рассчитаны отдельно по локусам яДНК и совместно с локусом мтДНК для того, чтобы показать вклад отцовского и материнского генома.
Генетические расстояния по микросателлитным локусам изменяются от 0,069 между пасеками Антипина Н.Т. д. Поршакова Красновишерского района Пермского края и Ватолина Г.А. д. Татарский Турыш Красноуфимского района Свердловской области до 0,397 между пасеками Юсуповой Р.А. д. Никифарово Альшеевского района республики Башкортостан и Селезнева Б.П. п. Раевка Альшеевского района республики Башкортостан. Генетические расстояния по микросателлитным локусам и локусу COI-COII мтДНК изменяются от 0,135 между пасеками Селезнева Б.П. п. Раевка Альшеевского района республики Башкортостан и Ватолина Г.А. д. Татарский Турыш Красноуфимского района Свердловской области до 0,613 между пасеками Юсуповой Р.А. д. Никифарово Альшеевского района республики Башкортостан и Селезнева Б.П. п. Раевка Альшеевского района республики Башкортостан.
На основе полученных генетических расстояний Nei (1987) была построена дендрограмма, отражающая генетические взаимоотношения локальных популяций, где пасека Ватолина Г.А. д. Татарский Турыш Красноуфимского района Свердловской области объединяется с пасекой Селезнева Б.П. п. Раевка Альшеевского района республики Башкортостан, а пасека Юсуповой Р.А. д. Никифарово Альшеевского района республики Башкортостан объединяется с пасекой Антипина Н.Т. д. Поршакова Красновишерского района Пермского края. Пасека Пискарева М.П. п. Раевка Альшеевского района республики Башкортостан примыкает на отдаленном расстоянии к последней группе. На дендрограмме, где рассматривается отдельно локальная популяция пчел Альшеевского района республики Башкортостан построенной только по микросателлитным локусам видно, что локальная популяция пчел Красновишерского района Пермского края и локальная популяция пчел Красноуфимского района Свердловской области объединяются в одну группу, тогда как локальная популяция пчел Альшеевского района республики Башкортостан располагается отдельно. В случае же включения локусов мтДНК локальная популяция пчел Альшеевского района республики Башкортостан группируется вместе с локальные популяцией пчел Красновишерского района Пермского края. Такое расположение можно объяснить тем, что в локальной популяции пчел Альшеевского района республики Башкортостан гибридизация шла в большей степени по отцовской линии, чем по материнской.
В альшеевской локальной популяции пчел Ho наблюдаемая гетерозиготность локальные популяции по данным анализа микросателлитных локусов 0,449 меньше Hs средней ожидаемой гетерозиготности субпопуляции 0,467 и Ht ожидаемой гетерозиготности локальные популяции 0,561, что говорит о незначительном дефиците гетерозигот.
Fis коэффициент инбридинга особей в субпопуляциях имеет близкое к 0 положительное значение 0,006, что говорит о незначительности отклонения от равновесия по Харди Вайнбергу. Fit коэффициент инбридинга субпопуляций также положителен 0,244, что говорит о некоторой доле инбридинга на уровне всей локальные популяции. Возможно, что наблюдается эффект Валунда, где для подразделенной локальные популяции наблюдается инбридинг на локальные популяционном уровне.
Значение Fst для всех микросателлитных локусов 0,244. Это говорит о подразделенности популяции пчел Альшеевского района, что дает популяции большую устойчивость. Такое значение Fst отражает 24% различий между пасеками Альшеевского р-на в среднем.
Наибольший уровень генного разнообразия по локусам ap243 и 4a110 со значениями 0,607 и 0,545 соответственно наблюдается в популяции пасеки Антипина Н.Т. д. Поршакова Красновишерского района Пермского края; по локусу a24 со значением 0,675 - в популяции пасеки Юсуповой Р.А. д. Никифарово Альшеевского района республики Башкортостан; по локусу a8 со значением 0,625 - в популяции пасеки Ватолина Г.А. д. Татарский Турыш Красноуфимского района Свердловской области; по локусу a43 со значением 0,600- в популяциях пасек Юсуповой Р.А. д. Никифарово и Пискарева М.П. п. Раевка Альшеевского района республики Башкортостан; по локусу a113 со значением 0,600 - в популяции пасеки Пискарева М.П. п. Раевка Альшеевского района республики Башкортостан, а в остальных популяциях наблюдалось нулевое значение, за исключением пасеки Юсуповой Р.А. д. Никифарово Альшеевского района республики Башкортостан; по локусу ap049 со значением 0,550 - в популяции пасеки Юсуповой Р.А. д. Никифарово Альшеевского района республики Башкортостан.
Таким образом, по разным локусам наблюдаются разные результаты, что говорит о независимом наследовании и разном уровне отбора локусов. Наибольший уровень генного разнообразия говорит о наибольшем биоразнообразии по данному локусу и наибольшей устойчивости. Кроме того, наибольший уровень генного разнообразия свидетельствует и об устойчивом поддержании биоразнообразия на высоком уровне, что может быть вызвано аутбридингом. По всем локусам наибольшие уровни генного разнообразия 0,504 и 0,525 наблюдаются в популяциях пасек Юсуповой Р.А. д. Никифарово и Пискарева М.П. п. Раевка Альшеевского района республики Башкортостан. По районам наибольшие уровни генного разнообразия со значениями 0,560 и 0,414 наблюдается в популяциях пчел Альшеевского района республики Башкортостан и Красноуфимского района Свердловской области, что может быть вызвано процессом гибридизации и разнообразящим отбором в дальнейшем.
In this paper were taken three local populations of bees apiaries Alsheevsky district of the republic of Bashkortostan, the local population of bees apiary Krasnovishersky district of the Perm region, previously defined as a population Ammellifera on the analysis of the locus of mtDNA COI-COII two microsatellite loci and ap243 4a110 (Ilyasov et al., 2006), and the local population of bees apiary Krasnoufimsky district of Sverdlovsk region, previously defined as a population of hybrid origin from the analysis of the locus of mtDNA COI-COII (Ilyasov et al., 2008).
Based on the analysis of polymorphism locus COI-COII mtDNA and microsatellite loci ap243, 4a110, a24, a8, a43, a113, ap049 nuclear DNA were calculated Nei genetic distances between the local populations. Genetic distances were calculated separately for microsatellite loci and loci separately using nuclear and mitochondrial DNA. Genetic distances were calculated for each apiary separately and for the local population of the district, which includes all of the apiary area. Genetic distances were calculated separately for the loci nDNA together and the locus of mtDNA to show the contribution of maternal and paternal genome.
Genetic distances of microsatellite loci vary from between 0,069 apiaries Antipina NT d. Porshakova Krasnovishersky district of the Perm region and Vatolina GA d. Turishev Krasnoufimsky Tatar district of Sverdlovsk region to between 0,397 apiaries Yusupova RA d. Nikifarovo Alsheevsky district of the republic of Bashkortostan and Seleznev BP n. Raevka Alsheevsky district of the republic of Bashkortostan. Genetic distances of microsatellite loci and the locus of mtDNA COI-COII vary from between 0,135 apiaries Selezneva BP n. Raevka Alsheevsky district of the republic of Bashkortostan and Vatolina GA d. Turishev Krasnoufimsky Tatar district of Sverdlovsk region to between 0,613 apiaries Yusupova RA d. Nikifarovo Alsheevsky district of the republic of Bashkortostan and Seleznev BP n. Raevka Alsheevsky district of the republic of Bashkortostan.
On the basis of genetic distances Nei (1987) was constructed dendrogram showing the genetic relationships of local populations where the apiary Vatolina GA d. Turishev Krasnoufimsky Tatar district of Sverdlovsk region is combined with the BP apiary Selezneva n. Raevka Alsheevsky district of the republic of Bashkortostan, and apiary Yusupova RA d. Nikifarovo Alsheevsky district of the republic of Bashkortostan is combined with the apiary Antipina NT d. Porshakova Krasnovishersky district of the Perm region. Apiary Piskareva MP n. Raevka Alsheevsky district adjoins the Republic of Bashkortostan in the remote distance to the last group. In the dendrogram, where the local population is considered separately bees Alsheevsky district of the republic of Bashkortostan built only microsatellite loci can be seen that the local bee population Krasnovishersky district of the Perm region and the local population of bees Krasnoufimsky district of Sverdlovsk region together in one group, while the local population Bee Alsheevsky district of the republic of Bashkortostan located separately. In the case of inclusion of mtDNA loci local bee population Alsheevsky district of the republic of Bashkortostan is grouped together with the local bee population Krasnovishersky district of the Perm region. This arrangement may be explained by the fact that the local bee population Alsheevsky district of the republic of Bashkortostan hybridization was largely paternal than maternal.
In Alsheevsky local bee population Ho observed heterozygosity local populations by analysis of microsatellite loci 0.449 less than the average expected heterozygosity Hs subpopulation 0.467 and Ht expected heterozygosity local populations 0.561, indicating a slight deficit of heterozygotes.
Fis the inbreeding coefficient of individuals in subpopulations has close to 0,006 0 positive, indicating that minor deviations from Hardy Weinberg equilibrium. Fit the inbreeding coefficient is also positive subpopulations of 0.244, indicating that some fraction of inbreeding at the level of the entire local populations. It is possible that the effect observed Valunda, where local populations subdivided inbreeding observed in the local population level.
Fst value for all microsatellite loci 0.244. This suggests subdivision bee population Alsheevsky area, giving a population greater stability. This value Fst represents 24% difference between apiaries Alsheevsky district average.
The highest level of genetic diversity at loci ap243 4a110 and with values ​​0.607 and 0.545 respectively, observed in the population apiary Antipina NT d. Porshakova Krasnovishersky district of the Perm region; locus a24 with the value 0.675 - in the population apiary Yusupova RA d. Nikifarovo Alsheevsky district of Bashkortostan Republic; locus a8 with a value of 0.625 - in the population apiary Vatolina GA d. Turishev Krasnoufimsky Tatar district of Sverdlovsk region; locus a43 with a value 0,600- populations apiaries Yusupova RA d. Nikifarovo and Piskareva MP n. Raevka Alsheevsky district of the republic of Bashkortostan; locus a113 with a value of 0.600 - in the population apiary Piskareva MP n. Raevka Alsheevsky district of the republic of Bashkortostan, as observed in other populations of zero, with the exception of the apiary Yusupova RA d. Nikifarovo Alsheevsky district of Bashkortostan Republic; locus ap049 with the value 0.550 - in the population apiary Yusupova RA d. Nikifarovo Alsheevsky district of the republic of Bashkortostan.
Thus, according to various loci observed different results, suggesting independent inheritance and different levels of selection loci. The highest level of genetic diversity suggests the greatest biodiversity on the locus and the greatest stability. In addition, the highest level of genetic diversity and demonstrates the sustainable maintenance of a high level of biodiversity that can be caused by outbreeding. For all loci highest levels of genetic diversity 0.504 and 0.525 observed in populations of apiaries Yusupova RA d. Nikifarovo and Piskareva MP n. Raevka Alsheevsky district of the republic of Bashkortostan. In areas of the highest levels of genetic diversity with the values ​​of 0.560 and 0.414 observed in populations of bees Alsheevsky district of the republic of Bashkortostan and Krasnoufimsky district of Sverdlovsk region, which may be caused by the process of hybridization and diversifying selection in the future.
  069. Ilyasov R.A., Komissar A.D., Poskryakov A.V., Nikolenko A.G. Are Ukrainian bees a separate race? Materials of international conference Apimondia. Monpellier. 2009. P. 300-302.  

ARE UKRAINIAN BEES A SEPARATE RACE? Ilyasov R., Komissar* A., Poskryakov A., Nikolenko A. Russia, Institute of genetic and biochemistry , Ufa (Central Russia) * Ukraine, editor of magazine “The circle of beekeepers” Ukrainian bee • Disposed in Ukraine and South–Western regions of Russia. They also were the main in the forming of so named Far East population of Russian bees as they were bring to these lands by migrants from Ukraine in far 19 century. • Old scientific name of Ukrainian bees is Apis mellifera acervorum Scorikov • M.Engel find in 1999 that this name is uncorrect and propose new one Apis mellifera sossimai Engel 1999 THE NEAREST RELATIVES • It exists several hypothesis: • 1) “the southern branch of dark forest Northern European bees A.m. mellifera” • 2) “the eastern branch of Central European bees A.m.carnica”, • 3) “result of long term mixing of Russian and Middle European bees” • 4) they belong to Mediterranean race Apis mellifera macedonica Ruttner 1988. F.Ruttner hypothesis (1988) Picture 14.1 from the F. Ruttner book “Biogeography and taxonomy of honey bees”,1988, Springer-Verlag (Berlin, New York, London, Paris, Tokyo). • Names of countries and Black sea are our. • Apis mellifera macedonica are disposed in Northern Greece, Bulgaria, Southern Romania and ??? Ukraine. Migration of bee races to the north and east in the post Pleistocenic warm period 8-10 000 yeas ago. Arrow of migration Macedonica bees to modern territory of Ukraine is absent. Information • F.Ruttner hadn’t enough material from Ukraine to say, that Ukrainian bees are macedonical ones. • He give name macedonica not in the honour of small country Macedonia, but in the honour of famous Greece military leader Alexander Makedonian Wings venation • According DAMINO analyses, made in Czech Institute of apiculture in Dol by DR. Kvetoslav Chermak majority of samples of Ukrainian bees are the same as standard A.m.macedonica. • The bees from the best of these colonies were investigated in Russian genetical centre (city Ufa in Central Russia) by DR. Ilyasov R., Poskryakov A. and Nikolenko A. Fragment ND2 of mitochondrial DNK were investigated Results were inserted in GenBank • Ilyasov R.A., Komissar A.D., Baymiev A.K., Poskryakov A.V., Nikolenko A.G. Phylogenetics researches in Apis mellifera macedonica concluded from mitochondrial DNA sequence , • GenBank. 2006. - accession numbers DQ361088-DQ361090. And compare with another results from GenBank • Marino A., Mantovani B., Carpana E., Sabatini A.G., Lodesani M. ND2 and CO1 mitochondrial genes in Apis mellifera (             ) L.: a molecular approach to Mediterranean populations monitoring // GenBank, submitted numbers AY114484 - AY136625. 2002. • Arias M.C., Sheppard W.S. Molecular philogenetics of honey bee subspecies (Apis mellifera L.) inferred from mitochondrial DNA sequence // Molecular philogenetics and evolution. 1996. V. 5. - V. 3. P. - 557-566 • Franck P., Garnery L., Celebrano G., Solignac M. et al. Hybrid origins of the Italian honeybees, Apis mellifera ligustica and A.m.sicula // Mol. Ecol. 2000. V. 9. P. 907-923. This fact contributes to the opinion that: • Ukrainian bees are not the separate race but they are Ukrainian population of Macedonian bees. So the F.Ruttner hypothesis is correct. • Of course, long term adaptation in the climatic condition of Ukraine and selection by beekeepers at the last 200 years (one moment from the point of view of the race evolution) create the population with characteristics, which differ from the modern bees from the Northern Greece. • We (A.Komissar, 2005) proposed name Apis mellifera macedonica var. ukrainica for the Ukrainian bees. • The scientific name Apis mellifera sossimai Engel 1999 can be used for Ukrainian bees before new argument will be find. VERY INTERESTING AND UBSOLUTELY UNSCIENTIFIC FACT without explanation • Macedonian bees are disposed in Northern Greece, Bulgaria, Macedonia, Part of Serbia, Southern Romania, Ukraine and Western-Southern region of Russia. • Namely these countries (and only these) have orthodox religion . But race of bees lived on the earth long before forming of different religion. • So it is possible to create the unscientific hypothesis about mutual influence of aboriginal bees to the life of human population. • This hypothesis is unscientific absolutely as well as any religion is unscientific also. • Race of honeybees Apis mellifera macedonica can be named as race of bees for the peoples, who practice orthodox religion • See : Komissar A. Races of honey bees, human nations and religions. Proceeding of the 3-rd Europian Congress on Social Insects, St. Petersburg, Russia, 22-27 August 2005, P. 61.  

  070. Ильясов Р.А., Шареева З.В. , Поскряков А.В., Николенко А.Г. Гетерогенность популяции северной части ареала башкирской пчелы. Материалы V Международной научной конференции "Факторы экспериментальной эволюции организмов". Алушта. 2009.С. 138-140.

Микросателлитный локус ap243 был представлен тремя аллелями 1, 2 и 2. При этом с максимальной частотой 0,80 аллель 1 была представлена в гибридной иглинской выборке, а в остальных колебалась в пределах 0,42 – 0,58, тогда как караидельская выборка имела промежуточное значение 0,70. Напротив, аллель 2 была минимальна в иглинской выборке (0,12), а в остальных варьировала в диапазоне 0,23-0,40. Реже всего встречалась аллель 3, частота которой в изучаемых выборках (за исключением бурзянской) в основном не превышала величины 0,10. В выборке из бурзянской популяции аллель 3 была представлена с частотою 0,35, что можно предположить в качестве маркера южной башкирской популяции. Распределение генотипов данного локуса показало, что наиболее представлен генотип 11 с частотой от 0,29 (бурзянская) до 0,70 (иглинская). Генотип 23 в бирской, караидельской и татышлинской популяциях отсутствовал. Гибридная иглинская популяция явно отличалась от остальных по частотам генотипа 11 – 0,70 и генотипа 22 – 0,03. Среди оставшихся также наблюдалась некоторая подразделенность: бурзянская выборка выделялась по частоте 0,26 генотипа 33, а бирская – мишкинская – караидельская группа – по частоте от 0,26 до 0,38 генотипа 12.
По результатам анализа другого ядерного маркера, микросателлитного локуса 4а110, можно отметить, что аллели 1 и 2 были представлены практически в равных долях, тогда как аллель 3 встречалась очень редко, либо совсем отсутствовала в выборках. Наиболее часто встречались генотипы 11 (0,20-0,60), 22 (0,10-0,28) и 12 (0,30-0,49). Частота встречаемости генотипов 33, 13 и 23 по многим выборкам была низкой (<0,05), а в некоторых составляла 0. Иглинская выборка отличилась от других частотами аллеля 1 (0,75 против 0,45-0,57 у прочих) и аллеля 2 (0,25 против 0,43-0,52), а также частотами генотипа 11 (0,60 против 0,20-0,33) и генотипа 22 (0,10 против 0,20-0,28). Частоты аллелей и генотипов в других выборках были приблизительно равными.
При изучении микросателлитного локуса А8 ядерной ДНК в исследуемых выборках пчел был обнаружен более широкий спектр аллелей, по сравнению с другими локусами, число которых в отдельных выборках достигало 5 (4 и 5 аллели были обнаружены в единичных случаях). Наиболее часто встречались генотипы 11, 13 и 33. Генотипы 12, 14 и 15 встречались редко (<0,05), а генотипы 22, 44, 55, 24, 25, 35 и 45 отсутствовали. Иглинская популяция отличалась от прочих частотами аллеля 1 (0,48 против 0,69-0,96) и аллеля 3 (0,48 против 0,02-0,27). Остальные аллели встречались достаточно редко. Помимо этого иглинская популяция выделялась по частотам генотипа 11 (0,17 против 0,40-0,80) и генотипа 33 (0,20 – против 0,00-0,08). По частоте генотипа 13 караидельская выборка (0,50) приближалась к иглинской (0,57 против 0,04-0,17 у четырёх оставшихся).
Таким образом, нами были получены предварительные результаты по полиморфизму трех микросателлитных локусов ар243, 4а110 и А8 ядерной ДНК в исследуемых и сравниваемых выборках пчел. Результаты показывают, что популяции северной части ареала башкирской пчелы полиморфны по трем микросателлитным локусам, что характеризует их значительную генетическую гетерогенность и высокий уровень биоразнообразия. Полученные результаты будут служить основой для получения основных генетических характеристик популяций пчел северной части ареала республики Башкортостан.
Ap243 microsatellite loci was represented by three alleles 1, 2 and 2. In this case the maximum rate of 0.80 1 allele was represented in the hybrid Iglinsky sample, and the rest ranged from 0.42 - 0.58, while the sample had an intermediate karaidelskaya value of 0.70. In contrast, allele 2 has been minimal in Iglinsky sample (0.12), and in other varied in the range of 0,23-0,40. Less often found 3 allele whose frequency in the studied samples (except Burzyan) generally did not exceed 0.10. In a sample of the population Burzyan allele 3 was presented with a frequency of 0.35, which can be assumed as a marker of the southern Bashkir population. The genotype distribution of the loci showed that the most represented genotype frequencies between 11 0.29 (Burzyansky) 0.70 (Iglinskiy). Genotype 23 Birsk, karaidelskoy and tatyshlinskoy populations absent. Hybrid Iglinskiy population is clearly different from the rest of the genotype frequencies of 11 - 22 genotype and 0.70 - 0.03. Among the remaining also observed some units: Burzyan sampling frequency allocated 0.26 genotype 33 and Birsk - Mishkinskoye - karaidelskaya group - in frequency from 0.26 to 0.38 genotype 12.
According to the analysis of other nuclear marker, microsatellite loci 4a110, it may be noted that the alleles 1 and 2 were represented in almost equal proportions, while allele 3 is very rare, or completely absent in the samples. Most frequent genotypes 11 (0,20-0,60), 22 (0,10-0,28) and 12 (0,30-0,49). The frequency of genotypes 33, 13 and 23 in many samples was low (<0.05), and some was 0. Iglinskiy Picks distinguished from other frequencies of allele 1 (0,45-0,57 at 0.75 against others), and allele 2 (0.25 vs. 0,43-0,52) and genotype frequencies 11 (0.60 versus 0,20-0,33) and 22 genotype (0.10 vs. 0,20-0,28) . The frequencies of alleles and genotypes in other samples were approximately equal.
In the study of microsatellite loci A8 nuclear DNA in the test samples it was detected bees wider range of alleles, in comparison to other loci in which the number of individual samples reached 5 (4 and 5 alleles were detected in a few cases). Most frequent genotypes 11, 13 and 33 genotypes 12, 14, and 15 are rare (<0.05), and genotypes 22, 44, 55, 24, 25, 35 and 45 were absent. Iglinskiy population differed from the other allele frequencies of 1 (0.48 versus 0,69-0,96) and allele 3 (0.48 versus 0,02-0,27). The rest of the alleles are rare. Besides Iglinskiy population stood at 11 genotype frequencies (0.17 versus 0,40-0,80) and genotype 33 (0.20 - against 0,00-0,08). According to the frequency of the genotype 13 karaidelskaya sample (0.50) approached Iglinsky (0,04-0,17 at 0.57 against the remaining four).
Thus, we have obtained preliminary results of polymorphism of three microsatellite loci ar243, 4a110 A8 and nuclear DNA in the study and compared samples of bees. The results show that the population of the northern part of the range of Bashkir bee in three polymorphic microsatellite loci that characterizes their significant genetic heterogeneity and a high level of biodiversity. The results will serve as the basis for key genetic characteristics of populations of bees northern part of the area of ​​the Republic of Bashkortostan.
  071. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Распределение аллелей микросателлитных локусов и локуса COI-COII мтДНК в популяции южной части ареала башкирских пчел. Материалы II Всероссийской конференции студентов, аспирантов и молодых учёных "Полевые и экспериментальные исследования биологических систем". Ишим. 2009. С. 70-75.  

Задачей нашего исследования является изучение популяций пчел южной части ареала башкирской пчелы. Ранее проведенные нами исследования показали, что башкирские пчелы по таксономии относятся к подвиду A.m.mellifera. Первоначально единственным местом сохранения чистых линий этой пчелы считался небольшой регион на юге Башкортостана, входящий в состав заповедника «Шульган-Таш» Республики Башкортостан. Дальнейшие исследования относились преимущественно к северной части ареала башкирской пчелы и не было проведено каких-либо исследований в обнаруженной первоначально популяции A.m.mellifera южной части ареала. Ареал этой южной локальной популяции не определен в точности, а именно, совпадает ли ареал с границами Бурзянского района или он гораздо шире.
Для исследования были отобраны пчелы из 5 выборок: с. Старосубхангулово (10 семей), с. Новомусятово (10 семей), с. Иргизлы (10 семей) Бурзянского района, с. Крутой Лог (5 семей) Абзелиловского района, с. Сюрень (4 семьи) Кугарчинского района Республики Башкортостан (рис. 1). В исследовании были использованы: локус COI-COII мтДНК, микросателлитные локусы ap243, 4a110, a8, a43 ядерной ДНК. Нами были рассчитаны частоты встречаемости аллелей каждого локуса.
Частоты встречаемости комбинаций межгенного локуса COI-COII мтДНК были следующими: в популяциях пчел всех выборок, кроме Сюрени, комбинация PQQ (маркер A.m.mellifera) встречалась с частотой 1,0, тогда как в Сюрени встречалась только комбинация Q (маркер A.m.caucasica) с частотой 1,0. Частоты аллелей микросателлитных локусов в изучаемых выборках Старосубхангулово, Новомусятово, Иргизлы, Крутой Лог и Сюрень представлены в таблице (таб. 1).  Для получения информации о распределении популяций необходимо рассчитать по частотам генетические расстояния. Наиболее приемлемым расстоянием является генетическое расстояние M. Nei (1978).
На основе данных о частотах распределения аллелей были рассчитаны генетические расстояния (таб. 2). Наибольшие расстояния наблюдается между популяциями Сюрень и Крутой Лог; Сюрень и Старосубхангулово. Наименьшие расстояния - между Крутой Лог и  Новомусятово; Старосубхагулово и  Новомусятово. Такая группировка, в некоторой степени согласована как с географическим расположением, так и генетическим составом этих популяций. В дальнейшем, был проведен кластерный анализ с использованием метода ближайшего соседа и построена дендрограмма (рис. 2). Так, популяция Сюрень отделяется от всех, так как в ней представлены в основном гибридные семьи пчел. Таким образом, картина кластерного анализа может отражать до некоторой степени уровень миграции между популяциями, где наиболее близкие популяции будут близки и генетически, тогда как отдаленные популяции будут более изолированы друг от друга.
Таким образом, проведенные исследования позволяют сделать вывод о том, что популяция южного ареала башкирских пчел A.m.mellifera, возможно имеет расширение в восточном направлении в сторону Абзелиловского района, тогда как на юге в Кугарчинском районе популяция была подвержена значительной гибридизации.
The aim of our research is to study the bee populations of southern part of the range of Bashkir bee. Earlier studies have shown us that the Bashkir bee taxonomy are subspecies Ammellifera. Initially, the only place save the clean lines of the bees was considered a small region in the south of Bashkortostan, which is part of the reserve "Shulgan-Tash" of the Republic of Bashkortostan. Further studies are concerned mainly to the northern part of the range of Bashkir bee and was not carried out any research in the detected initial population Ammellifera southern part of the range. The area south of the local population is not defined precisely, but it coincides with the boundaries of any area or district Burzyansky it is much wider.
For the study were selected from bees 5 samples: p. Starosubhangulovo (10 families), p. Novomusyatovo (10 families), p. Irgizly (10 families) region Burzyansky with. Krutoy Log (5 families) region Abzelilovsky with. Suresnes (4 families) region of the Republic of Bashkortostan Kugarchinskogo (Fig. 1). The study used: locus COI-COII mtDNA microsatellite loci ap243, 4a110, a8, a43 nuclear DNA. We calculated the frequency of alleles for each locus.
The frequency of occurrence of combinations intergenic locus COI-COII mtDNA were as follows: in populations of bees of all samples except Suresnes combination PQQ (marker Ammellifera) occurs with a frequency of 1.0, whereas in Suresnes met only the combination Q (marker Amcaucasica) with frequency 10. Allele frequencies of microsatellite loci in the study sample Starosubhangulovo, Novomusyatovo, Irgizly, Krutoy Log Suresnes and presented in a table (Table. 1). To obtain information about the distribution of the populations must be calculated for the frequency of genetic distance. The most acceptable is genetic distance distance M. Nei (1978).
On the basis of data on the distribution of allele frequencies were calculated genetic distances (Table. 2). The greatest distance observed between populations of Suresnes and Krutoy Log; Suresnes and Starosubhangulovo. The shortest distance - between Krutoy Log and Novomusyatovo; Starosubhagulovo and Novomusyatovo. This grouping, to some extent consistent with both the geographical location and the genetic composition of populations. Subsequently, a cluster analysis was performed using the nearest neighbor method and a dendrogram constructed (Fig. 2). Thus, the population is separated from all of Suresnes, since it contains mainly hybrid bee colonies. Thus, the picture cluster analysis may reflect to some degree the level of migration between populations where populations are closest and genetically close, while more distant populations are isolated from each other.
Thus, the studies suggest that the population of the southern area of ​​the Bashkir bee Ammellifera, perhaps has the extension eastward toward Abzelilovsky area, whereas in the south neighborhood Kugarchinskom population exposed to significant hybridization.
  072. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Охрана башкирской пчелы в заповеднике Шульган-Таш. Материалы 3 Международной научно-практической конференции "Сохранение разнообразия животных и охотничье хозяйство России". Москва. 2009. С.36-37.  

Первоначально ареал медоносной пчелы Apis mellifera mellifera L. охватывал обширную территорию от Британских островов до Урала, вдоль северной границы распространения вида. На данный момент ее ареал значительно сократился из-за внутривидовой гибридизации. Считается, что в настоящее время в Западной Европе практически невозможно найти негибридизованные семьи A.m.mellifera. В нашей стране A.m.mellifera также была подвержена интенсивной гибридизации в результате завоза пчел из южных регионов страны. Однако предполагалось, что в отдельных местах еще могли сохраниться популяции A.m.mellifera. Среди сохранившихся локальных популяций A.m.mellifera особо выделяется популяция башкирских бортевых пчел Бурзянском районе республики Башкортостан и взятая под охрану в заповеднике «Шульган-таш».
В 1958 году для охраны сохранившихся пчел A.m.mellifera в Бурзянском районе Республики Башкортостан был создан Заповедник «Шульган-таш» как филиал «Прибельский» восстанавливаемого Башкирского Государственного заповедника. В 1986 году по постановлению Совета Министров РСФСР от 6 января он преобразован в самостоятельный заповедник. Правительство РБ, администрации Бурзянского района и заповедника Шульган-Таш уделяют большое внимание сохранению бурзянской популяции. Большую помощь оказывают также международные организации, в частности, Всемирный фонд охраны дикой природы (WWF). На территории заповедника ведется племенная работа, администрацией района издан указ о запрете на ввоз пчел других подвидов, в 1997 году создан заказник «Алтын Солок». В 1997 году был создан заказник «Алтын Солок» и выделился как подразделение Бурзянского лесхоза. В зоне заказника находилось около 800 бортей, более 50 человек занимались бортничеством. В конце 80-х годов администрациями района и Республики был издан указ, запрещающий ввоз пчёл других подвидов на территорию района.
Одним из основных объектов охраны заповедника является башкирская пчела Бурзянского района, которая является достоянием Республики Башкортостан. Эта пчела отличаются чрезвычайной работоспособностью: в течение двух-трех недель цветения липы они могут работать с раннего утра до позднего вечера и способны даже в дождливую погоду, совершать огромное число вылетов, и собирать до 10 кг нектара в день.
Бортевые пчелы существуют в естественной среде, в суровых условиях и подвержены жесткому естественному отбору. Однако они не могут существовать абсолютно изолированно от пасек. Так как сама популяция бортевых пчел небольшая, она нуждается в постоянном пополнении за счет пасечных пчел. Поэтому окружающие пасеки играют большую роль. Между бортевыми пчелами и пасечными идет постоянная миграция, и эти процессы помогают сохранить популяцию. Подтверждением этого факта может послужить опыт Южноуральского заповедника, где с исчезновением деревень полностью исчезли и бортевые пчелы, хотя сами борти сохранились.
В настоящее время намечается расширение территории заповедника Шульган-Таш, что поможет сохранить биологическое и ландшафтное разнообразие широколиственных лесов, а, следовательно, и сохранить среду обитания бурзянских пчел. Расширение планируется примерно на 36 тыс. га в западном направлении. Там находятся неосвоенные территории на стыке Мелеузовского, Ишимбайского и Бурзянского районов, где нет населенных пунктов, животноводческих объектов, лесозаготовок и сохранились нетронутые человеком леса. В результате площадь охраняемых мест обитания бурзянской пчелы вместе с национальным парком «Башкирия» и заказником «Алтын Солок» может увеличиться до 230 тыс. га. При учреждении заповедника Шульган-Таш в его собственность были переданы около 900 бортей, правда лишь треть из них оказалась пригодной для эксплуатации. Поэтому в заповеднике ведется также работа по изготовлению и оснащению бортей.
На данный момент нет данных о границе распространения популяции бурзянских пчел. Для первоначальных исследований с целью определения распространения бурзянских пчел были отобраны пчелы из 5 выборок: с. Старосубхангулово, с. Новомусятово, с. Иргизлы Бурзянского района, с. Крутой Лог Абзелиловского района, с. Сюрень Кугарчинского района Республики Башкортостан. В исследовании были использованы: локус COI-COII мтДНК, микросателлитные локусы ap243, 4a110, a8, a43 ядерной ДНК. Нами были рассчитаны частоты встречаемости аллелей каждого локуса.
Частоты встречаемости комбинаций межгенного локуса COI-COII мтДНК были следующими: в популяциях пчел всех выборок, кроме Сюрени, комбинация PQQ (маркер A.m.mellifera) встречалась с частотой 1,0, тогда как в Сюрени встречалась только комбинация Q (маркер A.m.caucasica) с частотой 1,0.  Для получения информации о распределении популяций необходимо рассчитать частоты аллелей и генетические расстояния.
На основе данных о частотах распределения аллелей были рассчитаны генетические расстояния. Наибольшие расстояния наблюдается между популяциями Сюрень и Крутой Лог; Сюрень и Старосубхангулово. Наименьшие расстояния - между Крутой Лог и  Новомусятово; Старосубхагулово и  Новомусятово. Такая группировка, в некоторой степени согласована как с географическим расположением, так и генетическим составом этих популяций. В дальнейшем, был проведен кластерный анализ с использованием метода ближайшего соседа и построена дендрограмма. Так, популяция Сюрень отделяется от всех, так как в ней представлены в основном гибридные семьи пчел. Картина кластерного анализа может отражать до некоторой степени уровень миграции между популяциями, где наиболее близкие популяции будут близки и генетически, тогда как отдаленные популяции будут более изолированы друг от друга.
Таким образом, проведенные исследования позволяют сделать вывод о том, что ареал обитания бурзянской популяции башкирской пчелы A.m.mellifera, возможно имеет расширение в восточном направлении в сторону Абзелиловского района, тогда как на юге в Кугарчинском районе популяция была подвержена значительной гибридизации.
The original area of ​​the honey bee Apis mellifera mellifera L. covers a vast area from the British Isles to the Urals, along the northern border of the species distribution. At the moment, its range is much reduced because of intraspecific hybridization. It is estimated that currently in Western Europe is almost impossible to find a non-hybridized family Ammellifera. In our country Ammellifera was also subject to intense hybridization resulting in the importation of bees from the southern regions of the country. However, it was assumed that in some places could still keep the population Ammellifera. Among the remaining local populations Ammellifera highlights Bashkir wild-hive bee population Burzyan region of the republic of Bashkortostan and protected in the reserve "Shulgan-Tash."
In 1958, for the protection of the surviving bees Ammellifera Burzyan area in the Republic of Bashkortostan was established reserve "Shulgan-Tash" as a branch of "Pribelsky" restores the Bashkir State Nature Reserve. In 1986, by order of the RSFSR Council of Ministers of January 6, it is converted into a separate reserve. The Government of the Republic of Belarus, and the district administration Burzyansky Reserve Shulgan-Tash pay great attention to the preservation Burzyan population. Most care is provided by international organizations, in particular, the World Wildlife Fund (WWF). Within the reserve is being breeding work, the district administration issued a decree banning the importation of bees other subspecies in 1997 created reserve "Altyn Solok". In 1997, the reserve was established "Altyn Solok" and stood out as a division Burzyansky forestry. In the area of ​​the reserve was about 800 board, more than 50 people were engaged in apiculture. In the late 80-ies of the district administration and the Republic issued a decree banning the importation of bees other subspecies in the territory of the region.
One of the main objects of protection is to preserve the Bashkir bee Burzyansky district, which is the property of the Republic of Bashkortostan. This bee are extremely operability: within two or three weeks of flowering linden they can work from early morning until late at night and can even in the rain, to make a huge number of missions, and collect nectar up to 10 kg per day.
Wild-hive bee exist in the natural environment, in harsh conditions, and are subject to strict natural selection. However, they can not be completely isolated from the apiaries. Since the very small population of wild-hive of bees, it needs constant replenishment due apiary bees. So the surrounding apiaries play a big role. In the wild-hive bees and beekeeping is a constant migration, these processes help keep the population. Proof of this fact can serve as the experience of South Ural Reserve, where the disappearance of the villages have completely disappeared and wild-hive bee, though they remained aboard.
Currently planned expansion of the reserve Shulgan-Tash, which will help keep the biological and landscape diversity of deciduous forests, and, consequently, save the environment Burzyan bees. The expansion is scheduled for about 36 thousand. Ha in the western direction. There are undeveloped territory at the junction Meleuzovsky, Ishimbaisky Burzyansky and areas where there are no settlements, livestock facilities, harvesting and preserved untouched by man of the forest. As a result, the area of ​​protected habitat Burzyan bee along with the national park "Bashkiria" and reserve "Altyn Solok" may increase up to 230 thousand. Ha. In establishing the reserve Shulgan-Tash in his possession were handed over about 900 board, though only a third of them turned out to be suitable for use. Therefore, the reserve is also ongoing work on the construction and equipping of the board.
There is currently no data on the spread of the border population Burzyan bees. For the initial studies to determine the spread of Burzyan bee bees were selected from 5 samples: a. Starosubhangulovo with. Novomusyatovo with. Irgizly Burzyansky district with. Krutoy Log Abzelilovsky district with. Suresnes Kugarchinskogo district of Bashkortostan. The study used: locus COI-COII mtDNA microsatellite loci ap243, 4a110, a8, a43 nuclear DNA. We calculated the frequency of alleles for each locus.
The frequency of occurrence of combinations intergenic locus COI-COII mtDNA were as follows: in populations of bees of all samples except Suresnes combination PQQ (marker Ammellifera) occurs with a frequency of 1.0, whereas in Suresnes met only the combination Q (marker Amcaucasica) with frequency 10. For information on the distribution of populations is necessary to calculate allele frequencies and genetic distances.
Based on the distribution of allele frequencies were calculated genetic distance. The greatest distance observed between populations of Suresnes and Krutoy Log; Suresnes and Starosubhangulovo. The shortest distance - between Krutoy Log and Novomusyatovo; Starosubhagulovo and Novomusyatovo. This grouping, to some extent consistent with both the geographical location and the genetic composition of populations. Further, the cluster analysis was conducted using the method of the nearest neighbor and constructed dendrogram. Thus, the population is separated from all of Suresnes, since it contains mainly hybrid bee colonies. Painting cluster analysis may reflect to some degree the level of migration between populations where populations are closest and genetically close, while more distant populations are isolated from each other.
Thus, our studies suggest that habitat Burzyan Bashkir bee populations Ammellifera, perhaps has the extension eastwards towards Abzelilovsky area, while in the south district Kugarchinskom population exposed to significant hybridization.
  073. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Оценка генетического разнообразия в локальной популяции медоносной пчелы двух районов республики Башкортостан. Материалы I Всероссийской научно-практической конференции с международным участием "Проблемы сохранения биологического разнообразия волжского бассейна и сопредельных территорий". Чебоксары. 2010. С. 35-36.  

Генетическое разнообразие является главным показателем процессов, происходящих в популяции. На основе гетерозиготности также рассчитываются коэффициенты инбридинга популяции - основные показатели генетической структуры популяции. Целью нашей работы стало изучение генетического разнообразия популяции пчел на территории двух северных районов (Балтачевский и Бирский) Республики Башкортостан (табл. 1, рис. 1) на основе анализа полиморфизма 5 микросателлитных локусов (Ар243, 4а110, А8, А43, А113) ядерной ДНК. Fst - средний уровень генетической дифференциации между субпопуляциями; Fis - средний уровень инбридинга и отклонение от пропорций Харди-Вайнберга внутри субпопуляций; Fit - средний уровень инбридинга и отклонение от пропорций Харди-Вайнберга во всей популяции; Но - средняя наблюдаемая гетерозиготность внутри субпопуляций между локусами; Hs - средняя ожидаемая гетерозиготность внутри субпопуляций между локусами; Ht - средняя ожидаемая гетерозиготность во всей популяции между локусами; Qintra - среднее генное разнообразие внутри особей; Qinter - среднее генное разнообразие между особями; Нбалт - генное разнообразие в локальной популяции пчел на территории Балтачевского района Республики Башкортостан; Нбир - генное разнообразие в локальной популяции пчел на территории Бирского района Республики Башкортостан. По результатам анализа полиморфизма 5 микросателлитных локусов (Ар243, 4а110, А8, А43, А113) ядеркой ДНК нами были рассчитаны такие показатели F-статистики и гетерозиготности (табл. 2). Как видно из таблицы, популяция в целом по всем локусам испытывает очень незначительный дефицит гетерозигот Но (0,344)< Hs (0,419) и Ht (0,424). О дефиците гетерозигот говорит и Fis (0,164) для субпопуляций и Fit (0,185). Однако, по некоторым локусам (А43) наоборот наблюдается избыток гетерозигот Но (0,460)< Hs (0,428) и Ht (0,444), a Fis (-0,124) и Fit (-0,050). Оценка генного разнообразия по всем локусам для локальных популяций каждого района Республики Башкортостан показывает, что оно больше в популяции пчел Бирского района Нбир (0,466)> Нбалт (0,372), однако по некоторым локусам (А113) генное разннобразие больше в популяции пчел Балтачевского района Нбир (0,206)> Нбалт (0,168). Оценка среднего генного разнообразия по всем локусам внутри (Qintra) и между особями (Qinter) в локальной популяции пчел двух районов республики Башкортостан показала, что Qintra (0,359)< Qinter (0,429). Однако по некоторым локусам (А43) Qintra (0,500)> Qinter (0,445). Такие же результаты дает гетерозиготность, которая на уровне субпопуляций Hs (0,419) меньше гетерозиготности для всей популяции Hs (0,424). Коэффициент дифференциации популяций в локальной популяции пчел двух районов Республики Башкортостан Fst (0,026), что очень близко к нулевому значению. Это показывает очень малую степень внутрипопуляционной локальной дифференциации. По некоторым локусам (А8 и А43) Fst (0,069) и (0,066), что немного больше значения Fst по всем локусам. Таким образом, можно предположить, что в локальной популяции пчел двух районов (Бирский и Балтачевский) Республики Башкортостан происходит небольшая степень изоляции от потока генов из других локальных популяций пчел, что и привело к таким значениям коэффициентов инбридинга Fis и Fit, Также возможно, что отсутствие подраз- деленности популяций пчел двух районов республики Башкортостан является дополнительной причиной положительных значений коэффициентов инбридинга. Близкое к нулю значение коэффициента подраэделенности свидетельствует о неограниченном потоке генов и миграции между локальными популяциями пчел двух районов (Бирский и Балтачевский) Республики Башкортостан, несмотря на их некоторую незначительную географическую разобщенность. Генное разнообразие между особями больше, чем внутри особей в среднем, что выявляет запас генного разнообразия на популяционном уровне. Это может обеспечивать популяцию запасом устойчивости и изменчивостью на популяционном уровне.
Genetic diversity is the main indicator of the processes occurring in the population. Based heterozygosity and inbreeding coefficients calculated the population - the main indicators of the genetic population structure. The aim of our work was to study the genetic diversity of the population of bees in the territory two northern districts (Baltachevsky and Birsky) RB (Table. 1, Fig. 1) based on an analysis 5 microsatellite loci polymorphism (Ar243, 4a110, A8, A43, A113) of nuclear DNA. Fst - the average level of genetic differentiation between subpopulations; Fis - the average level of inbreeding and deviation from Hardy-Weinberg proportions within subpopulations; Fit - the average level of inbreeding and the deviation from Hardy-Weinberg proportions in the general population; But - the average observed heterozygosity in subpopulations between loci; Hs - the average expected heterozygosity in subpopulations between loci; Ht - average expected heterozygosity in the total population between loci; Qintra - the average gene diversity within individuals; Qinter - the average genetic diversity between individuals; Nbalt - genetic diversity in the local population bee on the territory of the Republic of Bashkortostan Baltachevskogo area; Nbir - genetic diversity in the local bee population in the territory of the Republic of Bashkortostan Birsk area. According to the analysis of polymorphism of 5 microsatellite loci (Ar243, 4a110, A8, A43, A113) Yaderku DNA we calculated these indicators F-statistics and heterozygosity (Table. 2). As the table shows, the population of in general, all the loci experiencing very small deficit of heterozygotes But (0,344) <Hs (0,419) and Ht (0.424). The deficit of heterozygotes and says Fis (0,164) for the subpopulations and Fit (0,185). However, for some loci (A43) on the contrary there is an excess of heterozygotes But (0,460) <Hs (0,428) and Ht (0,444), a Fis (-0,124) and Fit (-0,050). Assessment of genetic diversity for all loci for local populations of each region of the Republic of Bashkortostan shows that it is more in the bee population Birsk area Nbir (0.466)> Nbalt (0.372), but for some loci (A113) gene raznnobrazie more in the bee population Baltachevskogo district Nbir (0.206)> Nbalt (0.168). Estimate of the average gene diversity at all loci in (Qintra) and between individuals (Qinter) local bee population of the two districts of the republic of Bashkortostan showed that Qintra (0,359) <Qinter (0,429). However, some loci (A43) Qintra (0,500)> Qinter (0,445). The same results are obtained heterozygosity at which subpopulations Hs (0,419) less heterozygosity for the entire population Hs (0,424). The coefficient of differentiation of populations in the local bee population of the two districts of the Republic of Bashkortostan Fst (0,026), which is very close to zero. It shows a very low degree of intra- local differentiation. For some loci (A8 and A43) Fst (0,069) and (0,066), which is slightly greater than the Fst all loci. Thus, we can assume that the local bee population of two districts (Birsky and Baltachevsky) Republic of Bashkortostan takes a small degree of isolation from the flow of genes from other local populations bees, which led to such a coefficient of inbreeding Fis and Fit, also possible that the absence of podraz- concreteness bee populations of two districts of the Republic of Bashkortostan is an additional reason for the positive coefficient of inbreeding. Close to zero coefficient indicates podraedelennosti of unlimited gene flow and migration between the local bee population of two districts (Birsky and Baltachevsky) of the Republic of Bashkortostan, despite some minor geographical fragmentation. Genetic diversity between individuals is greater than the average within the individuals that brings the stock of genetic diversity at the population level. This may provide population stability margin and volatility the population level. 
  074. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Генное разнообразие медоносной пчелы в локальной популяции на севере республики Башкортостан. Материалы III Всероссийской научно-практической конференции "Биологические системы: устойчивость, принципы и механизмы функционирования". Нижний Тагил. 2010. С. 261.

Генное разнообразие является важнейшей характеристикой популяций, позволяющей определить ее устойчивость в целом. Целью нашей работы являлось изучение на основе анализа полиморфизма 5 микросателлитных локусов (Ap243, 4a110, A8, A43, A113) ядерной ДНК генетического разнообразия локальной популяции пчел на территории двух северных районов республики Башкортостан (Балтачевский (N=36) и Бирский(N=65)), ранее отнесенный нами к части ареала A.m.mellifera башкирского экотипа.
Таблица 1
Основные генетические характеристики локальной популяции медоносной пчелы республики Башкортостан
Локус    Ho    Hs    Ht    Fis    Qintra    Qinter    Fst    Fit    Hбалт    Hбир
Ap243    0,272    0,539    0,536    0,478    0,283    0,542    -0,010    0,473    0,525    0,552
4a110    0,527    0,531    0,530    0,009    0,533    0,537    -0,004    0,005    0,501    0,561
A8    0,371    0,409    0,425    0,107    0,391    0,438    0,069    0,169    0,274    0,543
A43    0,460    0,428    0,444    -0,124    0,500    0,445    0,066    -0,050    0,352    0,505
A113    0,091    0,187    0,187    0,524    0,087    0,183    0,001    0,524    0,525    0,552
Все    0,344    0,419    0,424    0,164    0,359    0,429    0,026    0,185    0,501    0,561
По результатам анализа полиморфизма 5 микросателлитных локусов (Ap243, 4a110, A8, A43, A113) ядерной ДНК нами были рассчитаны показатели F-статистики и гетерозиготности (Таб. 1). Популяция в целом по всем локусам испытывает незначительный дефицит гетерозигот Ho (0,344)< Hs (0,419), Ht (0,424) и Fit (0,185). Генное разнообразие в популяции пчел Бирского района Hбир (0,466)> чем Балтачевского Hбалт (0,372). Среднее генное разнообразие по всем локусам внутри особи Qintra (0,359)< чем между особями Qinter (0,429). Гетерозиготность на уровне субпопуляций Hs (0,419)< гетерозиготности для всей популяции Hs (0,424). Коэффициент дифференциации Fst (0,026) показывает очень малую степень внутрипопуляционной локальной дифференциации.
Таким образом, можно предположить, что в локальной популяции пчел двух районов республики Башкортостан (N=101) наблюдается отсутствие подразделенности и небольшая степень генетической изоляции. Предполагается, что между локальными популяциями пчел этих двух районов возможен неограниченный поток. Большой запас генного разнообразия обнаруживается на межпопуляционном уровне. По частотам генотипов не наблюдается значительного отклонения от равновесия Харди-Вайнберга.
Genetic diversity of honey bees in locales Noi POPULATION IN THE NORTH BASHKORTOSTAN
Genetic diversity is an essential characteristic of populations, allowing to determine its stability as a whole. The aim of our work was to study the analysis of polymorphism of 5 microsatellite loci (Ap243, 4a110, A8, A43, A113) nuclear DNA genetic diversity of local bee populations in the two northern regions of the Republic of Bashkortostan (Baltachevsky (N = 36) and Birsky (N = 65 )) was originally classified as a part of our range Ammellifera Bashkir ecotype.
Table 1
Main genetic characteristics of local honeybee population of the republic of Bashkortostan
Locus Ho Hs Ht Fis Qintra Qinter Fst Fit Hbalt Hbir
Ap243 0,272 0,539 0,536 0,478 0,283 0,542 -0,010 0,473 0,525 0,552
4a110 0,527 0,531 0,530 0,009 0,533 0,537 -0,004 0,005 0,501 0,561
A8 0,371 0,409 0,425 0,107 0,391 0,438 0,069 0,169 0,274 0,543
A43 0,460 0,428 0,444 -0,124 0,500 0,445 0,066 -0,050 0,352 0,505
A113 0,091 0,187 0,187 0,524 0,087 0,183 0,001 0,524 0,525 0,552
All 0.344 0.419 0.424 0.164 0.359 0.429 0.026 0.185 0.501 0.561
According to the analysis of polymorphism of 5 microsatellite loci (Ap243, 4a110, A8, A43, A113) nuclear DNA we calculated indicators F-statistics and heterozygosity (Tab. 1). The population as a whole for all loci experiencing a slight deficit of heterozygotes Ho (0,344) <Hs (0,419), Ht (0,424) and Fit (0,185). Genetic diversity in the population of bees Birsk district Hbir (0.466)> than Baltachevskogo Hbalt (0,372). Average genetic diversity for all loci in individuals Qintra (0,359) <than between individuals Qinter (0,429). Heterozygosity at subpopulations Hs (0,419) <heterozygosity for the entire population Hs (0,424). Differentiation factor Fst (0,026) shows a very low degree of intra-local differentiation.
Thus, we can assume that the local bee population of the two districts of the republic of Bashkortostan (N = 101), there is a lack of units and a small degree of genetic isolation. It is assumed that between the local bee population of the two areas is unrestricted flow. Large stock of genetic diversity found in the interpopulation level. At frequencies of genotypes no significant deviation from Hardy-Weinberg equilibrium. 
  075. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Генетический полиморфизм медоносной пчелы Apis mellifera mellifera L. южно-уральской горно-лесной популяции. Материалы Всероссийской научно-практической конференции "Актуальные проблемы сохранения биоразнообразия на охраняемых и иных территориях". Уфа. 2010. С. 190-193.  

Целью нашей работы был анализ молекулярно-генетической структуры бурзянской популяции Apis mellifera mellifera L., определение фаниц ареала и оценка степени ее полиморфизма. Для решения этих задач, с мая по сентябрь 2009 года, были взяты пробы в значительной части Бурзянского района, а также в сопредельных населенных пунктах Абзелиловского, Кугарчинского, Белорецкого, Баймакского и Зилаирского районов. Всего нами было собрано 695 образцов пчел со 119 пасек и И бортей. Материал исследовался на подвидовую принадлежность, частоту встречаемости аллелей, разнообразие генотипов. Нами был изучен полиморфизм микросатсллитных локусов ар243, 4а110, ар049, а24 ядерной ДНК. По результатам анализа частот аллелей микросатсллитных локусов были получены генетические расстояния, на основе которых кластерным анализом методом ближайшего соседа была построена дендрофамма генетических отношений населений пчел изучаемых нами популяций. На дендрофамме наблюдалось подразделение на 3 крупные ветви. Первая ветвь включала население пчел д. Атиково Бурзянского района, д. Иргизлы Бурзянского района, д, Старомусятово Бурзянского района, д. Новомусятово Бурзянского района; вторая - д. Кана Бурзянского района, д. Старосубхангулово Бурзянского района, д. Крутой лог Абзелиловского района, д. Сюрень Кугарчинского района; третья - д. Ямашево Бурзянского района. По результатам анализа наблюдаемых и ожидаемых частот генотипов микросателлитных локусов ар243, 4аПО, ар049, а24 ядерной ДНК был рассчитан коэффициент инбридинга Fis для изучаемых нами субпопуляций. Наибольший уровень инбридинга наблюдается в центре популяции (Fis изменялся от 0,22 до 0,45), а наименьший, максимально приближенный к состоянию равновесия - в д. Атиково Бурзянского района (Fis=0,15) и д. Сюрень Кугарчинского района республики Башкортостан (Fis=0,12). Для всех субпопуляций характерно наличие инбридинга и отсутствие аутбридинга. Таким образом, анализ полиморфизма ядерной и митохондриальной ДНК показал, что бурзянская популяция сохранилась практически чистопородной. Определилась часть фаниц ареала бурзянской популяции: северные (Белорецкий р-н), восточные (Абзелиловский р-н), юго-восточные (Баймакский р-н) и западные (Кугарчинекий, Мелеузовский и Ишимбайский районы). Установлено, что часть фаницы ареала бурзянской популяции медоносной пчелы проходит непосредственно по фанице с Кугарчи неким районом, гибридизованные пчелиные семьи могут находиться в непосредственной близости к заповеднику Шульган-Таш в его юго-западной части. Анализ полиморфизма выборок из Абзелиловского, Баймакского, Белорецкого ^ Зилаирского районов, может быть подтверждением гипотезы о более широком ареале бурзянской популяции медоносной пчелы Apis mellifera mellifera.

The aim of our work was to analyze the molecular genetic structure Burzyan populations Apis mellifera mellifera L., fanits definition and assessment of the range of its polymorphism. To solve these problems, from May to September 2009, samples were taken in a large part of Burzyansky area, as well as in the neighboring Abzelilovsky settlements, Kugarchinskogo, Beloretsk, Baimak and Zilair areas. In total we collected 695 samples of bees and apiaries with 119 and sides. The material was investigated on subspecies, the frequency of alleles, diversity of genotypes. We have studied the polymorphism loci mikrosatsllitnyh ar243, 4a110, ar049, A24 nuclear DNA. According to the analysis of allele frequencies mikrosatsllitnyh genetic loci were obtained distances at based cluster analysis method was nearest neighbor It built dendrofamma genetic attitude of the population of bees we study populations. On dendrofamme observed Unit 3 large branches. The first branch included population bee d. Atikovo Burzyansky area on. Irgizly Burzyansky area, etc., Staromusyatovo Burzyansky district, d. Novomusyatovo Burzyansky area; second - d. Burzyansky Cana region, d. Starosubhangulovo Burzyansky district, d. Abrupt log Abzelilovsky district, d. Suresnes Kugarchinskogo area; third - d. Yamasheva Burzyansky area. According to the analysis of the observed and expected frequencies genotypes of microsatellite loci ar243, 4aPO, ar049, A24 nuclear DNA was calculated inbreeding coefficient Fis we study subpopulations. The highest level of inbreeding observed in the center population (Fis varied from 0.22 to 0.45), and the lowest maximum close to equilibrium - in the village. Atikovo Burzyansky District (Fis = 0,15) and d. Kugarchinskogo Suresnes district of the republic Bashkortostan (Fis = 0,12). For all subpopulations characterized inbreeding and outbreeding absence. Thus, the analysis of polymorphisms of nuclear and mitochondrial DNA showed that the population remained Burzyan almost thoroughbred. Determine the area of ​​the fanits Burzyan population: the northern (Beloretsk district), eastern (Abzelilovsky district), southeastern (Baimaksky district), and Western (Kugarchineky, Meleuzovsky and Ishimbay areas). INSTALLATIONS, that part of the area fanitsy Burzyan honeybee population It goes directly to fanitse Kugarchi certain area, hybridized bee colonies may be in close proximity to the reserve Shulgan-Tash in its southwestern part. Analysis polymorphism in samples from Abzelilovsky, Baimak, Beloretsk ^ Zilair areas can be confirmation of the hypothesis of a more wide area Burzyan population of honey bee Apis mellifera mellifera.

  076. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Cравнительный секвенционный анализ вариабельного интрона гена фактора элонгации 1 альфа ядерного генома пчел рода Apis. В мире научных открытий. 2010. № 3 (09). Ч.3. С. 33-35.  

Нами был использован сравнительный секвенционный анализ вариабельного интрона гена фактора элонгации EF-1а ядерной ДНК с целью определения филогенетического паттерна пчел рода Apis. На дендрограмме наблюдается разделение на четыре группы, где в 1 группу вошли подвиды Apis mellifera, во 2 группу – представители гигантских пчел Apis dorsata, 3 группу – виды Apis koschevnikovi и Apis nuluensis, в 4 группу – карликовые пчелы Apis andreniformis и Apis florea.
Ключевые слова: Apis mellifera mellifera, Apis, медоносная пчела, интрон гена фактора элонгации EF-1a, секвенирование, кластерный анализ, дендрограмма, филогенетика.
We used comparative analysis sekventsionny variable intron of elongation factor EF-1 a nuclear DNA in order to determine the phylogenetic pattern of bees genus Apis. In the observed dendrogram divided into four groups, where one group comprised subspecies Apis mellifera, the 2nd group - representatives of giant bees Apis dorsata, group 3 - species Apis koschevnikovi and Apis nuluensis, 4 group - dwarf bee Apis andreniformis and Apis florea.
Keywords: Apis mellifera mellifera, Apis, honeybee, intron gene elongation factor EF-1a, sequencing, cluster analysis, dendrogram, phylogenetics.
  077. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Comparative sequencing analysis intron of elongation factor ef1-alpha of honeybees from Russian Ural. Materials of international conference "XLVII Naukowa konferencja pszczelarska". Pulawy. 2010. P. 57.  

Comparative sequencing analysis of variability (>40 per cent) intron of elongation factor gene EF1-alpha of nuclear DNA can be used in phylogenetic reconstruction genus Apis. In this work we have for the first time shown possibility using this marker in phylogenetic reconstruction in Apis mellifera species, in spite of its low intraspecific variability (<2 per cent).
We were made sequencing analysis fragment intron of elongation factor gene EF1-alpha of honey bees from 3 colonies of a northern area of Bashkir population honeybees Apis mellifera mellifera (Russia, Birsky region of Bashkortostan republic). Comparative analysis was made with published in genebank sequences: Apis andreniformis (Ay721702, Ay721703, Ay721704), Apis dorsata (Ay721705, Ay721706, Ay721707), Apis florea (Ay721708, Ay721709), Apis mellifera ligustica (Ay721710), Apis koschevnikovi (Ay721711, Ay721712, Ay721713, Ay721714, Ay721715); Apis mellifera lamarckii (Ay721716); Apis nuluensis (Ay721717) (Arias, Sheppard, 2005).
Using cluster analysis we construct dendrogram by neighbor-joining method. On dendrogram bee samples had differentiated into four branches. Samples of different bee species clustered in separate branches. The first branch included samples of western honeybee Apis mellifera. Apis mellifera mellifera from Ural located separately from other subspecies. Samples of gigantic Asian bees of genus Apis have differentiated into a second branch of Apis dorsata. Asian bees of species Apis koschevnikovi and Apis nuluensis included into a third branch. These two bee species had low level of genetic differentiating among themselves. The fourth branch included bee species of Asian dwarf bees of species Apis andreniformis and Apis florea. Bee samples of each of them separated in different subgroups.
  078. Fakhretdinova S.A., Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Granice zasiegu populacji pszczol miodnych Burzyan gatunku Apis mellifera mellifera L. Materials of international conference "XLVII Naukowa konferencja pszczelarska". Pulawy. 2010. P. 56.  

Na Uralu wyst^puje kilka populacji Apis mellifera mellifera L. W Baszkirii najbardziej znana to populacja Burzyan. Jest to jedna z najbardziej bliskich naturze, zyj^cych w stanie dzikim pszczola. Pszczoly Burzyan charakteryzuj^ si^ glownie tym, iz gniazda swoje buduj^ w dziuplach drzew. W celu zachowania puli genowej populacji pszczol Burzyan powinno okreslic si^ dokladnie granice zasi^gu ich wyst^powania. W tym celu, przyst^pilismy do zbierania danych dotycz^cych wyst^powania tej pszczoly w powiecie Burzyan. Dokonano analizy polimorfizmu mitochondrialnego (locus intergenic COI-COII) i j^drowego (loci ap243, 4a110, ap049 i a24) w genomie ww populacji . Wyniki wskazuj^ na utrzymywanie si^ populacji w calej badanej strefie. Okreslono granice zasi^gu populacji Burzyan: polnocna (Beloretsky), wschodnia (Abzelilovsky), poludniowo-wschodnia (Baymaksky) i zachodnia (Kugarchinsky, Meleuzovsky i Ishimbaysky). Mozna to wyjasnic korzystnymi warunkami naturalnymi: polozenie geograficznym, jak i wyst^powaniem specyficznej roslinnosci. Powiat Burzyan jest bowiem polozony w dolinie mi^dzy dwoma pasmami gorskimi: Ural-Tau i Alatau. Stanowi to zatem naturaln^ barier^ dla swobodnego przeplywu genow. W granicach administracyjnych Ishimbaysky, Meleuzovsky na przestrzeni wielu kilometrow kwadratowych znajduj^ si^ tereny nie zamieszkale, co przyczynia si^ takze do utrwalenia izolacji i utrzymania granic zasiogu wyst^powania pszczol Burzyan. Po wschodniej stronie granicy kraju wyst^puje glownie obszar lasow sosnowych, co w znacznym stopniu ulatwia zachowanie czystosci genetycznej omawianej populacji.
  079. Колбина Л.М., Непейвода С.Н., Масленников И.В., Воробьева С.Л., Ильясов Р.А., Поскряков А.В., Николенко А.Г. Генетический и морфологический анализ породности пчелиных семей шарканского и завьяловского районов удмуртской республики. Материалы международнародной научно-практической конференции "Современное пчеловодство. Проблемы, опыт, новые технологии". Ярославль. 2010. С. 71-73.  

На сегодняшний день существует две основные методики определения породной принадлежности пчел, ни одну из которых не стоит
абсолютизировать. Молекулярно-генетическая методика позволяет
оценить происхождение пчелиных семей независимо от их морфологических признаков и часто позволяет ныинить гибридов в тех случаях, когда методика оценки жетерьера дает сбои. Но, несмотря на все дос шине 1 на молекулярно-генетической методики у нее есть и cvuKCTHCHHbiii недостаток. Поскольку аборигенными пчелами для нсего 11оно.1ЖЬЯ, н том числе и Удмуртии были среднерусские пчелы, то есть пчелы Apis mellifera mellifera L., а завезенные семьи южных пород составляли небольшой процент от общего количества разводимых пчел. Это привело к тому, что большая часть гибридизации местных пчел произошла по мужской линии, которую использованная молекулярно-генетическая методика, к сожалению, учесть не может, С другой стороны большая вариабельность морфологических признаков, появившаяся в результате гибридизации, привела к тому, что часть помесных пчел может по экстерьеру соответствовать среднерусской породе, ей по сути не являясь. Поэтому достоверные результаты могут быть получены только при использовании как морфологических, так и молекулярно-генетических методов исследования.
Нами были проанализированы пчелиные семьи из двух районов Шарканского (2 пасеки - 15 семей из села Нижнее Корякино и 19 из Шаркана) и Завьяловского (3 пасеки - 19 семей из села Люк, 15 - Постол и 5 - из деревни Макарово). Был проведен сравнительный популяционно-генетический анализ пчелиных семей этих двух районов, а также сравнительный анализ отдельно по пасекам на основе изучения межгенного локуса COI-COII мтДНК.
Исследования по генетическому анализу проводилась совместно с РА. Ильясовым, А.Г. Николенко из института биохимии и генетики Уфимского научного центра РАН. Основу генетического анализа составил установленный ранее полиморфизм межгенного локуса COI-COII у представителей разных подвидов A.mellifera. Установлено, что протяженный АТ-богатый межгенный участок мтДНК. локализованный между генами COI и СОИ. не кодирующий аминокислотной последовательности, может быть использован в качестве маркера для различения подвидов A.m.mellifera и A.m.caucasica благодаря вариабельности длины, обусловленной различным соотношением элементов Р и Q, где межгенный участок у представителей ветви М (A.m.mellifera), аборигенных для республики, имеет комбинацию PQQ, тогда как у представителей ветви С (A.m.caucasica, A.m.camica. A.m.ligustica), гибридизация с которыми наблюдается на территории республики, имеется единственный элемент Q. Таким образом, межгепный локус СО [-СО II мтДНК у представителей эволюционной ветви С и их гибридов по материнской линии на 268 п.н. короче межгенного локуса COI-COII мтДНК у представителей ветви М, и эти локусы легко разделяются при электрофорезе. Размер продукта ПЦР межгенного локуса COI-COII мтДНК, включающий и ген тРНКЬеи у представителей A.m.mellifera, равен примерно 600 п.н., а у представителей эволюционной ветви С и их гибридов по материнской линии - 350 п.н. Этот маркер был использован нами для поиска популяций A.m.mellifera.
Для сравнительного анализа была использована методика оценки экстерьера согласно рекомендациям всероссийского научноисследовательского института пчеловодства.
При изучении межгенного локуса COI-COII митохондриальной ДНК, при анализе по двум районам (табл.1.) заметно, что встречаемость строения межгенного локуса Q больше чем в два раза выше в завьяловский популяции, что говорит о происхождении 38,5% пчелиных семей завьяловской популяции по материнской линии от пчел южных пород. Кроме этого следует отметить наличие в Шарканской популяции аномального строения межгенного локуса С01-С0П митохондриальной ДНК PQ. Обнаруженные различия между этими двумя популяциями достоверны (Р<0,05).
В результате ни одна из исследованных популяций не может быть отнесена к среднерусской породе пчел. При этом две популяции - люкская и макаровская, по материнской линии происходят по данным анализа митохондриальной ДНК предположительно происходят от Apis mellifera mellifera. однако сильно гибридизорованы по отцовской линии. В это же время, несмотря на неоднородное происхождение, шарканская популяция сохранила больше признаков аборигенной среднерусской породы. Корякннская популяция при совместном рассмот рении генетических и морфологических данных ближе всех остальных к абориилшой популяции среднерусских пчел.
Today, there are two basic methods for determining the breed of bees, none of which is not necessary
absolute. Molecular genetic technique allows
to assess the origin of bee families, regardless of their morphological characters and often allows nyinit hybrids in cases where assessment methodology zheterera faltering. But, despite all the dos bus 1 at the molecular and genetic techniques, and it has cvuKCTHCHHbiii disadvantage. As for native bees nsego 11ono.1ZhYa, including Mr. and Udmurtia were Central Russian bees, ie bee Apis mellifera mellifera L., and imported breeds of southern families represent a small percentage of the total farmed bees. This led to the fact that most of the hybridization of native bees occurred in the male line, which used molecular genetic techniques, unfortunately, can not be taken into account, on the other hand a large variability in morphological characters, which appeared as a result of hybridization has led to the fact that part of the hybrid Bees can match the exterior of the Central Russian breed, it is essentially not being. Therefore, accurate results can be obtained only when using both morphological and molecular genetic methods.
We analyzed bee families of the two areas Sharkansky (2 apiaries - 15 families from the village of Lower Koryakina and 19 of shuffling) and Zavyalovsky (3 apiaries - 19 families from the village of Luc, 15 - Postol and 5 - from the village Makarovo). A comparative population-genetic analysis of colonies of these two areas, as well as a comparative analysis separately for apiaries based on the study of intergenic locus COI-COII mtDNA.
Studies on the genetic analysis was conducted in conjunction with RA. Ilyasov, AG Nikolenko from the Institute of Biochemistry and Genetics, Ufa Scientific Center, Russian Academy of Sciences. The basis of genetic analysis was installed earlier polymorphism intergenic locus COI-COII representatives of different subspecies A.mellifera. It was found that the extended AT-rich intergenic site mtDNA. localized between genes COI and soybeans. does not encode an amino acid sequence it can be used as a marker to distinguish between subspecies Ammellifera and variability thanks Amcaucasica length due to various elements of the relationship of P and Q, where the representatives of intergenic site branches of M (Ammellifera), native to the country, is a combination of PQQ whereas the representatives of branches with (Amcaucasica, Amcamica. Amligustica), hybridization with whom there is in the country, there is a unique element Q. So mezhgepny locus CO [-CO II mtDNA from representatives of evolutionary branches with their hybrids maternal 268 bp short intergenic locus COI-COII mtDNA from representatives of branches of M and these loci are easily separated by electrophoresis. The size of the PCR product intergenic locus COI-COII mtDNA gene and comprising the representatives tRNKei Ammellifera, is about 600 bp, and the representatives of the evolutionary branches with their hybrids and the maternal line - 350 bp This marker was used to search for our populations Ammellifera.
For a comparative analysis was used according to the method of estimating exterior All-Russian scientific and research institute of the recommendations of the bee.
In the study of intergenic locus COI-COII mitochondrial DNA, the analysis of the two areas (Table 1). Evident that the incidence structure intergenic locus Q more than twice as high in Zavyalovsky population that speaks of the origin of 38.5% of bee colonies Zavyalovsky Population maternal bees southern rock. In addition, it should be noted the presence of an abnormal population structure Sharkan intergenic locus C01-S0P mitochondrial DNA PQ. The differences between these two populations were significant (P <0.05).
As a result, none of the studied populations can not be attributed to the Central Russian breed of bees. At the same time two populations - lyukskaya and Makarovskaya, maternal occur according to the analysis of mitochondrial DNA presumably come from Apis mellifera mellifera. however much gibridizorovany paternal. At the same time, despite the origin of the non-uniform, Sharkan population kept growing signs native of Central Russian breed. Koryaknnskaya population is under the joint rhenium Consider genetic and morphological data closer to the rest of the population aboriilshoy Central Russian bees.
  080. Салтыкова Е.С., Ильясов Р.А., Гайфуллина Л.Р., Поскряков А.В., Ямиданов Р.С., Николенко А.Г. Изменение уровня экспрессии антимикробных пептидов в организме медоносной пчелы Apis mellifera mellifera L. Материалы международнародной научно-практической конференции "Современное пчеловодство. Проблемы, опыт, новые технологии". Ярославль. 2010. С. 159-160.  

Антимикробные пептиды (АМП) в организме медоносной пчелы играют важную роль в иммунитете и выживаемости. Два наиболее известных из них дефензин и абецин. Нами был проведен ПЦР в режиме реального времени по результатам поставленного эксперимента при однократном кормлении пчел 0,001% раствором хитозана. После кормления пчел экстрагировалась мРНК, на основе которой синтезировалась кДНК для последующей ПЦР в режиме реального времени (ПЦР РВ). Целью нашего эксперимента стала проверка влияния хитозана на уровень экспрессии антимикробных пептидов абецина и дефензина у медоносной пчелы. Ген MGST в эксперименте использовался в качестве контроля, как ген, на экспрессию которого не должно влиять кормление хитозаном.
Нами были получены данные об уровне изменения экспрессии каждого антимикробного пептида в отдельности в двух повторностях. По результатам поставленных экспериментов после кормления пчел хитозаном можно заключить, что уровень экспрессии дефензина имеет тенденцию к увеличению на 142% (P=0,053) в 1 эксперименте и на 96% (P=0,033) во 2 эксперименте. Уровень экспрессии абецина увеличился на 188% (P<0,001) в 1 эксперименте и на 100% (P<0,001) во 2 эксперименте (Таб. 1), (Рис. 1).
Таким образом, можно предположить, что однократное кормления пчел 0,001% раствором хитозана приводит к заметному увеличению уровня экспрессии антимикробных пептидов дефензина (в 2-2,8 раз) и абецина (в 1,9-2,4 раза) в организме медоносной пчелы Apis mellifera mellifera.
Antimicrobial peptides (AMPs) in the body of the honeybee play an important role in immunity and survival. The two most prominent of these defensin and abetsin. We carried out the PCR in real time from the results of the experiment with a single staged feeding of bees 0.001% solution of chitosan. After feeding, the bees extracted mRNA from which the cDNA was synthesized for subsequent PCR in real time (real-time PCR). The purpose of our experiment was to check the effect of chitosan on the level of expression of antimicrobial peptides and abetsina defensin in the honeybee. MGST gene used in the experiment as a control as the gene for expression of which should not affect feeding chitosan.
We obtained data on the changes in the expression level of each of the antimicrobial peptide separately in duplicate. According to the results of experiments set after feeding bees chitosan it can be concluded that the expression level of defensin tends to increase by 142% (P = 0,053) in one experiment and by 96% (P = 0,033) in the two experiments. The expression level of abetsina increased by 188% (P <0,001) in experiment 1 and 100% (P <0,001) in experiment 2 (Table. 1) (Fig. 1).
Thus, it can be assumed that a single foraging bees 0.001% chitosan solution leads to a marked increase in the level of expression of defensin antimicrobial peptides (in 2-2,8 times) abetsina (a 1.9-2.4-fold) in the body of the honeybee Apis mellifera mellifera.
  081. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Генное разнообразие и коэффициенты инбридинга медоносной пчелы в локальной популяции на севере Республики Башкортостан. Материалы III всероссийской научно-практической конференции "Полевые и экспериментальные исследования биологических систем". Ишим. 2010. С. 66-68.  

Естественный ареал Apis mellifera L. охватывает всю Африку, Европу и Ближний Восток. Отличительная черта вида – значительная внутривидовая дифференциация (Ruttner, 1988). По современной классификации (Engel, 1999) вид подразделен на 25 подвидов.  За последние 60-70 лет во многих регионах России и странах Западной Европы произошла массовая гибридизация пчел, что привело к необратимым процессам, препятствующим восстановлению исходного местного генофонда. В результате сильно пострадала среднерусская пчела, которая практически исчезла в некоторых местах ее традиционного разведения (Черевко, 2005; Кривцов, 2000, 2008).
В России еще сохранились резервы генофонда A.m.mellifera, которые можно использовать для восстановления популяции на границах его естественного ареала (Билаш, 1991; Лебедев, Билаш, 1991; Кривцов, 2005). Одной из наиболее известных популяций темной лесной пчелы является башкирская, фактические данные о состоянии генофонда которой публиковались в последнее десятилетие лишь несколькими авторами. В 2000 году на основе анализа полиморфизма межгенного локуса COI-COII мтДНК и морфометрических данных на территории Республики Башкортостан было показано существование лишь одной сохранившейся аборигенной бурзянской популяции A.m.mellifera (Саттаров, Николенко, 2000; Николенко, Поскряков, 2002). В дальнейшем поиск сохранившихся резерватов генофонда этого подвида был продолжен, и на севере республики была обнаружена еще одна локальная популяция A. m. mellifera в Татышлинском районе Республики Башкортостан (Ильясов с соавт., 2006). Для сохранения генофонда ценного подвида A.m.mellifera как в России, так и в Республике Башкортостан, необходимо иметь несколько генетических резерватов, располагать информацией об их популяционно-генетической структуре и границах ареалов составляющих его локальных популяций (Николенко, Поскряков, 2002). Целью исследований было изучение структуры популяции медоносной пчелы северного ареала Республики Башкортостан.
Нами были изучены пчелы с 42 пасек трех северных районов (Бирский, Караидельский, Мишкинский). Всего было проанализировано по микросателлитным локусам ар243, 4а110 и А8 ядерной ДНК пчел из 211 семей исследуемых районов Республики Башкортостан. В изучаемой выборке пчел нами были рассчитаны F-коэффициенты и гетерозиготность. Использование в анализе F-коэффициентов и гетерозиготностей позволяет наиболее полноценно и всесторонне охарактеризовать популяции и сравнивать их с аналогичными показателями других популяций. Кроме того, эти характеристики позволяют говорить о процессах, происходящих в популяции и прогнозировать дальнейшую динамику популяции. Анализ средних значений последних по микросателлитным локусам ap243, 4a110 и А8 ядерной ДНК (Табл. 1) показал, что популяция северного ареала башкирской пчелы характеризуется низким уровнем генетической дифференциации (FST=0,015) между субпопуляциями, что свидетельствует о возможном единстве происхождения пчел из этих популяций.
Близкие к нулю значения коэффициентов инбридинга (FIS=0,122 и FIT=0,135) и близкие значения наблюдаемой (HО=0,435) и ожидаемых (HS=0,485 и HТ=0,493) показателей гетерозиготности отражают баланс между инбридингом и аутбридингом, как в отдельных субпопуляциях, так и во всей популяции, в целом, а также свидетельствуют о том, что распределение генотипов по всем локусам приближается к равновесному по Харди-Вайнбергу. Такое равновесное состояние дает возможность длительного существования популяции в современных неизменных условиях окружающей среды.
Таблица 1
F-коэффициенты и гетерозиготность популяции северной ареала башкирской пчелы A.m.mellifera
FST*    FIS    FIT    HО    HS    HТ
0,015    0,122    0,135    0,435    0,485    0,493
* FST - средний уровень генетической дифференциации между субпопуляциями; FIS – средний уровень инбридинга и отклонение от пропорций Харди-Вайнберга внутри субпопуляций; FIT – средний уровень инбридинга и отклонение от пропорций Харди-Вайнберга во всей популяции; HT - средняя ожидаемая гетерозиготность во всей популяции между локусами; HO – средняя наблюдаемая гетерозиготность внутри субпопуляций между локусами; Hs – средняя ожидаемая гетерозиготность внутри субпопуляций между локусами.

Таким образом, популяция северного ареала башкирской пчелы A.m.mellifera характеризуется отсутствием подразделенности между населениями пчел Бирского, Караидельского и Мишкинского районов. Минимальное отклонение от равновесия Харди-Вайнберга свидетельствует об устойчивости популяции во времени и незначительном влиянии на нее факторов эволюции. Наблюдаемые коэффициенты инбридинга в популяции можно принять за оптимальные равновесные значения, которые сложились в течение продолжительного времени становления северной популяции A.m.mellifera, которые можно использовать в сравнении с другими популяциями.
The natural habitat of Apis mellifera L. covers the whole of Africa, Europe and the Middle East. A distinctive feature of the form - a significant intraspecific differentiation (Ruttner, 1988). According to modern classification (Engel, 1999) view is divided into 25 sub-species. Over the past 60-70 years in many regions of Russia and countries of Western Europe there was a mass of bees hybridization, leading to irreversible processes, prevent recovery of the original local gene pool. As a result, I suffered greatly Central Russian bee, which has virtually disappeared in some areas of its traditional breeding (Cherevko, 2005; Krivtsov, 2000, 2008).
The Russian Federation remains of the gene pool reserves Ammellifera, which can be used to restore the population on the borders of its native range (Bilash, 1991; Lebedev, Bilash, 1991; Krivtsov, 2005). One of the most famous dark forest bee populations is Bashkir, evidence on the state of the gene pool which is published in the last decade, only a few authors. In 2000, based on the analysis of polymorphism of the intergenic locus COI-COII mtDNA and morphometric data on the territory of the Republic of Bashkortostan has been shown the existence of only one surviving indigenous populations Burzyan Ammellifera (Sattar, Nikolenko, 2000; Nikolenko, Poskryakov, 2002). In the future, search for the remaining reserves of the gene pool of this subspecies was continued, and in the north of the country has found another local population of A. m. mellifera in Tatyshlinskom area Bashkortostan (Ilyasov et al., 2006). To preserve the gene pool of valuable subspecies Ammellifera both in Russia and in the Republic of Bashkortostan, it is necessary to have some genetic reserves, to have information about their population-genetic structure and the boundaries of the ranges of its constituent local populations (Nikolenko, Poskryakov, 2002). The aim was to study the structure of the honey bee population of the northern area of ​​the Republic of Bashkortostan.
We have studied bees with 42 apiaries three northern regions (Birsky, Karaidelsky, Mishkinskoye). There were analyzed for microsatellite loci ar243, 4a110 and A8 nuclear DNA of 211 families of bees studied areas of the Republic of Bashkortostan. In our sample of bees we calculated F-ratios and heterozygosity. Using the analysis of F-ratios and heterozygous allows most fully and comprehensively characterize the population, and to compare them with those of other populations. In addition, these characteristics allow us to speak about the processes occurring in the population and to predict the future dynamics of the population. Analysis of the average of the last of microsatellite loci ap243, 4a110 A8 and nuclear DNA (Table. 1) showed that the population of the northern area of ​​the Bashkir bee is characterized by a low level of genetic differentiation (FST = 0,015) between subpopulations, suggesting a possible common origin of these populations of bees .
Near-zero coefficient of inbreeding (FIS = 0,122 and FIT = 0,135) and similar values ​​observed (HO = 0.435) and expected (HS = 0,485 and HT = 0.493) heterozygosity indices reflect a balance between inbreeding and outbreeding, in certain subpopulations, as and in the population as a whole, as well as evidence that the distribution of genotypes at all loci close to the equilibrium of Hardy-Weinberg equilibrium. This equilibrium state allows continued existence of the population in modern constant environmental conditions.
Table 1
F-ratios and heterozygosity of the population of northern area of ​​the Bashkir bee Ammellifera
FST * FIS FIT BUT HS HT
0.015 0.122 0.135 0.435 0.485 0.493
* FST - the average level of genetic differentiation between subpopulations; FIS - average level of inbreeding and deviation from Hardy-Weinberg proportions within subpopulations; FIT - the average level of inbreeding and deviation from Hardy-Weinberg proportions in the general population; HT - average expected heterozygosity in the total population between loci; HO - average observed heterozygosity in subpopulations between loci; Hs - the average expected heterozygosity in subpopulations between loci.

Thus, the population of the northern area of ​​the Bashkir bee Ammellifera characterized by lack of division between the population of bees Birsk, Karaidelskogo and Mishkinsky areas. Minimum deviation from Hardy-Weinberg equilibrium demonstrates the stability of the population in time and insignificant effect on her evolutionary factors. The observed rates of inbreeding in the population can be taken for optimal equilibrium values ​​that have been established for a long time the formation of northern populations Ammellifera, which can be used in comparison with other populations.
  082. Салтыкова Е.С., Ильясов Р.А., Гайфуллина Л.Р., Поскряков А.В., Ямиданов Р.С., Николенко А.Г. Экспрессия антимикробных пептидов абецина и дефензина в организме медоносной пчелы Apis mellifera mellifera. Материалы третьей международной научно-практической конференции "Актуальные вопросы энтомологии". Ставрополь. 2010. С. 85.  

Антимикробные пептиды (АМП) в организме медоносной пчелы играют важную роль в иммунитете и выживаемости. Два наиболее известных из них дефензин и абецин. Нами был проведен ПЦР в режиме реального времени по результатам поставленного эксперимента при однократном кормлении пчел 0,001% раствором хитозана. После кормления пчел экстрагировалась мРНК, на основе которой синтезировалась кДНК для последующей ПЦР в режиме реального времени (ПЦР РВ). Целью нашего эксперимента стала проверка влияния хитозана на уровень экспрессии антимикробных пептидов абецина и дефензина у медоносной пчелы. Ген MGST в эксперименте использовался в качестве контроля, как ген, на экспрессию которого не должно влиять кормление хитозаном.
Нами были получены данные об уровне изменения экспрессии каждого антимикробного пептида в отдельности в двух повторностях. По результатам поставленных экспериментов после кормления пчел хитозаном можно заключить, что уровень экспрессии дефензина имеет тенденцию к увеличению на 142% (P=0,053) в 1 эксперименте и на 96% (P=0,033) во 2 эксперименте. Уровень экспрессии абецина увеличился на 188% (P<0,001) в 1 эксперименте и на 100% (P<0,001) во 2 эксперименте.
Таким образом, можно предположить, что однократное кормления пчел 0,001% раствором хитозана приводит к заметному увеличению уровня экспрессии антимикробных пептидов дефензина (в 2-2,8 раз) и абецина (в 1,9-2,4 раза) в организме медоносной пчелы Apis mellifera mellifera.
Antimicrobial peptides (AMPs) in the body of the honeybee play an important role in immunity and survival. The two most prominent of these defensin and abetsin. We carried out the PCR in real time from the results of the experiment with a single staged feeding of bees 0.001% solution of chitosan. After feeding, the bees extracted mRNA from which the cDNA was synthesized for subsequent PCR in real time (real-time PCR). The purpose of our experiment was to check the effect of chitosan on the level of expression of antimicrobial peptides and abetsina defensin in the honeybee. MGST gene used in the experiment as a control as the gene for expression of which should not affect feeding chitosan.
We obtained data on the changes in the expression level of each of the antimicrobial peptide separately in duplicate. According to the results of experiments set after feeding bees chitosan it can be concluded that the expression level of defensin tends to increase by 142% (P = 0,053) in one experiment and by 96% (P = 0,033) in the two experiments. The expression level of abetsina increased by 188% (P <0,001) in experiment 1 and 100% (P <0,001) in the 2nd experiment.
Thus, it can be assumed that a single foraging bees 0.001% chitosan solution leads to a marked increase in the level of expression of defensin antimicrobial peptides (in 2-2,8 times) abetsina (a 1.9-2.4-fold) in the body of the honeybee Apis mellifera mellifera.
  083. Фахретдинова С.А., Ильясов Р.А., Поскряков А.В., Николенко А.Г. Определение границ бурзянской популяции медоносной пчелы Apis mellifera mellifera L. Материалы третьей международной научно-практической конференции "Актуальные вопросы энтомологии". Ставрополь. 2010. С. 154-155.  

На Урале известно несколько сохранившихся популя - mellifera mellifera L. В Башкирии это северная и южная (Т ^ ская) популяции. Уникальность бурзянской популяции заюткГ^' ся в высокой степени естественной изоляции, вследствие чего^' пуляция меньше подвержена гибридизации. Кроме того, этоо™ из наиболее интактных популяций тёмной лесной пчелы среди™ хранившихся в наши дни. Бурзянская популяция характеризуется также наличием большого числа бортевых семей. Для решения проблемы сохранения генофонда как бортевых пчел, так и популяции в целом важно знать генетические процессы происходящие внутри и в краевых зонах популяции. Кроме того, бортевые пчелы не обладают минимальной численностью для сохранения генофонда и нуждаются в постоянном его пополнении за счет пасечных пчел. Анализ полиморфизма митохондриального (межгенный локус С 0 1 - С 0 П ) и ядерного (локусы ар243, 4а 110, ар049 и а24) геномов показал, что бурзянская популяция сохранилась практически чистопородной. Небольшая степень гибридизации, обнаруженная нами на территории заповедника Шульган-Таш, ничтожнамала. Такой умеренный, на наш взгляд, приток генов не д о лж е н вы вать серьезных нарушений в генофонде с у б п о п у л я ц и и . ^ Определилась часть границ ареала бурзянской подул ^ верные (Белорецкий р-н), восточные (Абзелиловскии Р восточные (Баймакский р-н) и западные (КугаРчинс* ^ ареала зовский и Ишимбайский р-ны). Такие очертания ^гр^ ге0Гр3фи- объясняются, прежде всего, естественными ФаКр ° ^ яНСКий Ра1*оН ческим положением и растительным покровом. УР ^ й длатаУ’ расположен в долине между двумя хребтами. Р ^ оЛЯЦЙи и сП\ что обеспечивает высокую степень е с т е с т в е н н о й ^ ^ стороН^ жит естественным барьером на пути потока ге районов н, „ет н а с ел ен ны х пунктов, что тоже способствуе т е километры » твеНной границей ареала. Восточную Гизоляиии и служи у тау> обесПечивает также природная 1яиЦУ- кРоМепес^ в „ практически полное отсутствие медоносов, зона ‘осНОВ“ 1 и из Зилаирского района показал, что бу рзянская диализ вьГО°РК‘паНИЧивается пределами Бурзянского района, „опуляиия не 01 р часть границы ареала бурзянской популяции установлено> енно п0 границе с Кугарчинским районом, проходит неп и показала принадлежность этих пчел к кавказ- выборка из к п '|б р н д и з о в а н нЫ е пчелиные семьи могут находить- СК0'Непосредственной близости к заповеднику Шульган-Таш в его юго-западной части. In the Urals there are several surviving popula- - mellifera mellifera L. In Bashkortostan is the northern and southern (T ^ Skye) population. The uniqueness of the population Burzyan zayutkG ^ ' Xia highly natural insulation, whereby ^ ' populations less susceptible to hybridization. In addition, Eto'o ™ of the most intact populations of bees among the dark forest ™ kept today. Burzyan population characterized as the presence of a large number of family tree hollow. To solve the problem of preservation of the gene pool as a tree hollow bees and the general population, it is important to know the genetic processes occurring both inside and in the marginal areas of the population. Moreover, wild-hive the bees do not have the minimum number to save genetic resources and need constant replenishment of its by beekeeping bees. Analysis of mitochondrial polymorphism (intergenic locus C 0 1 - P P 0) and nuclear (loci ar243, 4a 110 ar049 and A24) genomes It showed that the population remained virtually Burzyan thoroughbred. A small degree of hybridization detected us on the reserve Shul'gan-Tash nichtozhnamala. Such moderate, in our opinion, the influx of genes of the left ventricle is not d e n you Vat serious violations in the gene pool with y b n o p y l i i and u. ^ Define the boundaries of the area Burzyan blew ^ right (Beloretsk district), eastern (P Abzelilovsky Eastern (Baimaksky district) and western (* ^ KugaRchins area zovsky Ishimbay and districts). These outlines ^ c ^ ge0Gr3fi- explained primarily by natural faqr ° ^ Jansky PA1 * oH cal position and vegetation. UR ^ th dlataU ' Located in a valley between two mountain ranges. Pj oLYaTsYi and SP \ which provides a high degree of e s t e s t e n n in a second side of the ^ ^ ^ tains a natural barrier to the flow areas n n, "a district and ate with us en pips, which is also contributing to the te kilometers "Twain border area. East Gizolyaiii and served with tau> also provides a natural 1yaiTsU- kRoMepes ^ in "almost complete absence of honey plants, Zone 'of "1 and from Zilair district showed that boo rzyanskaya Dialysis vGO ° RK'paNIChivaetsya outside Burzyansky area "01 p opulyaiiya not part of the border area population Burzyan set> enno n0 Kugarchinskim border area, ting passes and showed those belonging to the Caucasian bees a sample of n '| b n d p and s to us in a n e bee colonies can be situated SK0'Neposredstvennoy proximity to the reserve Shulgan-Tash in his south-western part. 

  084. Николенко А.Г., Ильясов Р.А., Поскряков А.В. Информативность полиморфизма мт-ДНК медоносной пчелы Apis mellifera L. (Hymenoptera: Apidae) в популяционно-генетических исследованиях. Материалы II Симпозиума стран СНГ по перепончатокрылым насекомым. Санкт-Петербург. 2010. С. 106.  

Зональные перемещения пчел, скрещивание разных подвидов в про граммах улучшения и размножения привели к потере некоторых полезных свойств генофонда. За последние 60-70 лет во многих регионах России и странах Западной Европы произошла (и происходит) массовая гибридизация пчел, что привело к необратимым процессам, препятствующим восстановлению исходного местного генофонда. В результате сильно пострадала среднерусская пчела, которая практически исчезла в некоторых местах ее традиционного разведения (Черевко, 2005; Кривцов, 2000,2008). Тем не менее в России еще сохранились резервы генофонда А т. mellifera L., которые можно использовать для восстановления популяции на границах его естественного ареала (Билаш, 1991; Лебедев, Билаш, 1991; Кривцов, 2005). Одной из наиболее известных популяций темной лесной пчелы является башкирская, фактические данные о состоянии генофонда которой публиковались в последнее десятилетие лишь несколькими авторами. В 2000 г. на основе анализа полиморфизма межгенного локуса COICOII мтДНК и морфометрических данных на территории Башкортостана показано существование лишь одной сохранившейся аборигенной бурзян- ской популяции А. т. mellifera (Саттаров, Николенко, 2000; Николенко, Поскряков, 2002). В дальнейшем поиск сохранившихся резерватов генофонда этого подвида был продолжен, и на севере республики (Татышлин ский район) была обнаружена еще одна локальная популяция А. гп. те lifera (Ильясов и др., 2006). Мы предположили, что ареал северной попу ляции А. т. mellifera республики может быть шире (Шареева и др., ^ Для сохранения генофонда ценного подвида А. т. mellifera как в ^ сии, так и в Республике Башкортостан, необходимо иметь несколько г ^ тических резерватов, располагать информацией об их поп^ЛЯЦИ1°ьНЫХ генетической структуре и границах ареалов составляющих его лок популяций (Николенко, Поскряков, 2002). Zonal movement of bees, crossing different subspecies in the pro grams improvement and propagation led to some loss of useful the properties of the gene pool. Over the past 60-70 years in many regions of Russia and Western Europe there was (and is happening) mass hybridisation bees, leading to irreversible processes, hindering recovery source of local gene pool. As a result, severely damaged Central Russian bee, which has virtually disappeared in some places its traditional breeding (Cherevko, 2005; Krivtsov, 2000.2008). Nevertheless, the Russian Federation remains of the gene pool reserves A m. Mellifera L., which can be used to restore the population in the the limits of its natural range (Bilash, 1991; Lebedev, Bilash, 1991; Krivtsov, 2005). One of the most known populations of the dark forest Bashkir bee is, the actual data on the state of the gene pool which were published in the last decade, only a few authors. In 2000, based on the analysis of polymorphism of the intergenic locus COICOII mtDNA and morphometric data in Bashkortostan It demonstrated the existence of only one surviving aboriginal burzyan- tion of the population of A. m. mellifera (Sattar, Nikolenko, 2000; Nikolenko, Poskryakov, 2002). In the future, search for the remaining reserves of the gene pool this subspecies was continued, and in the north of the country (Tatyshlin sky district) was discovered another local population of A. r. those lifera (Ilyasov et al., 2006). We assumed that the area of the northern ass tion A. m. mellifera republic may be wider (Shareeva et al., ^ To preserve the gene pool of valuable subspecies A. m. Mellifera in ^ these, as well as in the Republic of Bashkortostan, it is necessary to have some r cal reserves, to have information about their pop LYATSI1 ° ^ NYH genetic structure and boundaries of areas of its component Locos populations (Nikolenko, Poskryakov, 2002). 
  085. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Филогенетический анализ медоносной пчелы северной башкирской популяции. Материалы докладов XXIV Любищевских чтений "Современные проблемы эволюции". Ульяновск. 2010. С. 113-119.  

Нами были просеквенированы нуклеотидные последовательности фрагмента интрона гена фактора элонгации EF-1a у медоносных пчел из 3 семей с севера ареала башкирской популяции Apis mellifera mellifera (Бирский район республики Башкортостан). Как можно отметить, нуклеотидная последовательность интрона гена фактора элонгации EF-1а ядерной ДНК вариабельна среди представителей рода Apis – 105 вариабельных сайтов, что составляет более 40%. Вариабельность этого локуса среди представителей вида Apis mellifera, напротив, очень низка - 4 вариабельных сайта, что составляет около 2%. Кроме того, среди представителей пчел рода Apis наблюдается большие участки с инсерциями и делециями, которые не были использованы при подсчете уровня вариабельности, что может повысить его уровень (Табл. 1).
По результатам сравнительного анализа нуклеотидных последовательностей фрагмента интрона гена фактора элонгации EF-1a семей медоносных пчел с севера ареала башкирской популяции A.m.mellifera: 3504 Birsk Apis mellifera mellifera (Бирск, Башкортостан); 3502 Birsk Apis mellifera mellifera (Бирск, Башкортостан); 3503 Birsk Apis mellifera mellifera (Бирск, Башкортостан) с последовательностями, опубликованными в генбанке: Ay721702 Apis andreniformis, Ay721703 Apis andreniformis; Ay721704 Apis dorsata, Ay721705 Apis dorsata, Ay721706 Apis dorsata; Ay721707 Apis dorsata, Ay721708 Apis florea; Ay721709 Apis florea; Ay721710 Apis mellifera ligustica; Ay721711 Apis koschevnikovi; Ay721712 Apis koschevnikovi; Ay721713 Apis koschevnikovi, Ay721714 Apis koschevnikovi; Ay721715 Apis koschevnikovi; Ay721716 Apis mellifera lamarckii; Ay721717 Apis nuluensis (Arias, Sheppard, 2005) методом кластеризации ближайшего соседа программой MEGA 3.1 была построена дендрограмма генетических отношений разных видов рода Apis (Рис. 1).
На дендрограмме наблюдается разделение на четыре группы. Представители каждого вида преимущественно кластеризуются в отдельные группы. В первую группу вошли представители западной медоносной пчелы вида Apis mellifera, обладающие довольно низким уровнем вариабельности между подвидами. Сюда же вошли представители Apis mellifera mellifera Южного Урала. Во вторую группу вошли представители гигантских азиатских пчел вида Apis dorsata, характеризующиеся малой степенью вариабельностью между экотипами. В третью группу вошли представители азиатских пчел видов Apis koschevnikovi и Apis nuluensis. Эти два вида пчел имеют очень низкую степень генетической дифференциации между собой, тогда как некоторые экотипы Apis koschevnikovi отличаются очень сильно. В четвертую группу вошли представители азиатских карликовых пчел видов Apis andreniformis с Apis florea. Представители каждого из них располагаются в отдельных подгруппах, которые дифференцированы на относительно высоком уровне. Из всех проанализированных видов пчел рода Apis гигантские пчелы вида Apis dorsata наиболее генетически близки к западной пчеле вида Apis mellifera.
Секвенционный анализ фрагмента интрона гена фактора элонгации EF-1a, возможно, позволяет провести филогенетическую реконструкцию рода Apis, что также представлено в работе M.C.Arias, W.S.Sheppard (2005). Предполагается, что даже наблюдаемый низкий уровень дивергенции позволит получить данные о филогенетическом паттерне вида Apis mellifera при исключении из анализа представителей других видов рода Apis, на фоне высокого уровня вариабельности которых внутривидовая вариабельность Apis mellifera существенно принижается.
В дальнейшем мы попытались провести филогенетический анализ внутри вида A.mellifera. На основе сравнительного анализа нуклеотидных последовательностей фрагмента интрона гена фактора элонгации EF-1a вида A.mellifera семей с севера ареала башкирской популяции A.m.mellifera с последовательностями Ay721710 A.mellifera ligustica и Ay721716 A.mellifera lamarckii, опубликованными в генбанке, методом кластеризации ближайшего соседа программой MEGA 3.1 нами была построена дендрограмма филогенетических отношений разных подвидов Apis mellifera (Рис. 2). Представители разных подвидов на дендрограмме группируются раздельно. Это показывает возможность использования фрагмента интрона гена фактора элонгации EF-1a для решения вопросов внутривидовой филогении, несмотря на то, что между подвидами наблюдаются только 4 сайта замен (Табл. 1). Таким образом ядерный маркер - интрон гена фактора элонгации EF-1a эффективен в решении проблем систематики и филогенетики как на родовом, так и видовом уровнях. Такое свойство этого маркера можно применить к российским условиям, так как уже давно отмечается проблема массовой гибридизации подвидов медоносной пчелы из южных и северных регионов России. В частности, для республики Башкортостан существует проблема сохранения аборигенного подвида A.m.mellifera от гибридизации с привозными медоносными пчелами разных подвидов из южных регионов России и Ближнего Зарубежья. Ранее нами для идентификации подвидов медоносной пчелы использовались преимущественно маркеры митохондриальной ДНК. Дополнительное использование ядерных маркеров наряду с митохондриальными позволит пролить свет на процессы и пропорции отцовского и материнского наследования в гибридных популяциях медоносной пчелы.
We have sequenced the nucleotide sequence of a fragment of an intron of the gene elongation factor EF-1a in honey bees from three families from the north area of ​​the Bashkir population of Apis mellifera mellifera (Birsky region of the republic of Bashkortostan). As can be noted, the nucleotide sequence of intron of the elongation factor EF-1a nuclear DNA is variable among members of the genus Apis - 105 variable sites, representing more than 40%. The variability of this locus among the species Apis mellifera, on the contrary, very low - 4 variable site, which is about 2%. Furthermore, among the genus Apis bees observed large areas with insertions and deletions, which were not used in calculating the level of variability that can increase its level (Table. 1).
According to the results of the comparative analysis of the nucleotide sequences of the intron of the gene fragment elongation factor EF-1a family of honeybees from the north area of ​​the Bashkir population Ammellifera: 3504 Birsk Apis mellifera mellifera (Birsk, Bashkortostan); 3502 Birsk Apis mellifera mellifera (Birsk, Bashkortostan); 3503 Birsk Apis mellifera mellifera (Birsk, Bashkortostan) with sequences published in GenBank: Ay721702 Apis andreniformis, Ay721703 Apis andreniformis; Ay721704 Apis dorsata, Ay721705 Apis dorsata, Ay721706 Apis dorsata; Ay721707 Apis dorsata, Ay721708 Apis florea; Ay721709 Apis florea; Ay721710 Apis mellifera ligustica; Ay721711 Apis koschevnikovi; Ay721712 Apis koschevnikovi; Ay721713 Apis koschevnikovi, Ay721714 Apis koschevnikovi; Ay721715 Apis koschevnikovi; Ay721716 Apis mellifera lamarckii; Ay721717 Apis nuluensis (Arias, Sheppard, 2005) by the nearest neighbor clustering program MEGA 3.1 was constructed dendrogram genetic relationships of different species of the genus Apis (Fig. 1).
In the observed dendrogram divided into four groups. Representatives of each species predominantly clustered into individual groups. The first group included representatives of the western honey bee species Apis mellifera, have relatively low variability between subspecies. This also includes representatives of Apis mellifera mellifera Southern Urals. The second group included representatives of the giant Asian bee species Apis dorsata, characterized by a low degree of variability among ecotypes. The third group included representatives from the Asian bee species Apis koschevnikovi and Apis nuluensis. These two types of bees have a very low degree of genetic differentiation between them, while some ecotypes of Apis koschevnikovi differ greatly. The fourth group includes representatives of Asian dwarf bee species Apis andreniformis with Apis florea. Representatives of each of them are located in separate groups which are differentiated to a relatively high level. Of all the analyzed species of the genus Apis bees giant bee species Apis dorsata most genetically close to the western bee species Apis mellifera.
Sekventsionny analysis fragment intron of the elongation factor EF-1a, may allows for phylogenetic reconstruction of the genus Apis, which is also represented in the MCArias, WSSheppard (2005). It is expected that even low levels of divergence observed will provide data on the phylogenetic pattern of species Apis mellifera to the exclusion from the analysis of other species of the genus Apis, coupled with a high level of variability that intraspecific variability of Apis mellifera significantly belittled.
In the future, we tried to carry out phylogenetic analysis within the species A.mellifera. On the basis of a comparative analysis of the nucleotide sequences of the intron of the gene fragment elongation factor EF-1a species A.mellifera families from the north area of ​​the Bashkir population Ammellifera sequences Ay721710 A.mellifera ligustica and Ay721716 A.mellifera lamarckii, published in GenBank, the nearest neighbor clustering method MEGA program 3.1 we constructed a dendrogram of phylogenetic relationships of different subspecies Apis mellifera (Fig. 2). Representatives of different subspecies in the dendrogram grouped separately. This shows the possibility of using a gene intron fragment elongation factor EF-1a to address intraspecific phylogeny, despite the fact that between the subspecies observed only substituting 4 sites (Tab. 1). Thus the nuclear marker - intron gene elongation factor EF-1a is effective in solving problems of systematics and phylogenetics as generic and species levels. This property of this marker can be applied to Russian conditions, as has long been noted the problem of mass hybridization honeybee subspecies of the southern and northern regions of Russia. In particular, for the Republic of Bashkortostan there is the problem of preservation of aboriginal subspecies Ammellifera by hybridization with imported honeybees of different subspecies of the southern regions of Russia and abroad. Earlier we have to identify subspecies of honeybee mainly used mitochondrial DNA markers. The additional use of nuclear markers along with mitochondrial will shed light on the processes and proportions of paternal and maternal inheritance in hybrid populations of the honey bee.
  086. Ильясов Р.А., Петухов А.В., Поскряков А.В., Николенко А.Г. Популяция медоносной пчелы Среднего и Южного Урала. Материалы VIII Межрегионального совещания энтомологов Сибири и Дальнего Востока "Энтомологические исследования в Северной Азии". Новосибирск. 2010. C. 91-93.  

Нами были собраны медоносные пчелы Apis mellifera из 43 семей с 2 пасек заповедника Шульган-Таш Бурзянского района республики Башкортостан (пасека Капова-Пещера кордон заповедника; пасека п.Коран-Елга), из 52 семей с 6 пасек Башкирской опытной станции пчеловодства Иглинского района республики Башкортостан (п.Улу-Теляк, пасека Гареева; п.Улу-Теляк, пасека матковыводная; п.Улу-Теляк, пасека Орловская; п.Улу-Теляк, пасека Кугейко; п.Улу-Теляк, пасека Громова; п.Улу-Теляк, пасека Шамсуринская), из 37 семей с 8 пасек Юсьвенского района Коми-Премяцкого округа Пермского края (с.Архангельское, пасека Кривощекова Д.Ф.; с.Юсьва, пасека Быкова Н.А.; с.Почашор, пасека Сторожева В.М.; д.Федотово, пасека Власова В.Д.; д.Федорово, пасека Бояндина А.Г.; пасека д.Б.Они; пасека д.Доег; пасека д.Пожва). Всего было проанализировано 132 семьи медоносной пчелы.
Для изучения генетической структуры населения медоносной пчелы Среднего и Южного Урала мы анализировали полиморфизм локуса COI-COII митохондриальной ДНК и микросателлитных локусов ap243, 4a110, a24 и a8. В трех локальных популяциях медоносной пчелы (бурзянская, иглинская и юсьвенская) наблюдались следующие частоты аллей.
Межгенный локус COI-COII мтДНК у медоносной пчелы представлен 4 состояниями, где единственный элемент Q на Урале характеризует происхождение по материнской линии от подвидов пчел из южных регионов – A.m.caucasica, A.m.carnica, A.m.ligustica и других. Все остальные комбинации элементов P и Q на Урале характеризуют медоносную пчелу подвида A.m.mellifera по материнской линии. Бурзянская и юсьвенская популяции характеризуются максимальным содержанием пчел, происходящих от A.m.mellifera по материнской линии.
Уровень гетерозиготности является одним из основных показателей в популяционно-генетическом анализе пчел, характеризующий величину биологического и генного разнообразия. Для популяции медоносной пчелы известно, что избыточная и недостаточная гетерозиготность ведет к неблагоприятным явлениям. Для популяции медоносной пчелы в норме, по результатам наших многолетних исследований в России, свойственен небольшой дефицит гетерозигот (Ильясов с соавт., 2008). Мы рассчитали величину средней наблюдаемой гетерозиготности внутри субпопуляции HO и сравнили ее со средней ожидаемой гетерозиготностью внутри субпопуляции. Во всей популяции по всем микросателлитным локусам ядерной ДНК наблюдается дефицит гетерозигот HO (0,413) < НS (0,444). Гетерозиготность внутри субпопуляций НS (0,444) больше гетерозиготности между субпопуляциями DST (0,039). Величина межпопуляционной генетической дифференциации GST для всей популяции небольшая и приближается к значению 0,080.
Показатели гетерозиготности для каждой локальной популяции также различались. Наибольший дефицит гетерозигот наблюдался в иглинской локальной популяции HO (0,562) < НS (0,469), а наименьший - в юсьвенской HO (0,347) < НS (0,389). Межпопуляционная составляющая гетерозиготности DST наименьшая в бурзянской локальной популяции DST (0,000), а наибольшая - в иглинской DST (0,012). Соответственно, наименьшая величина межпопуляционной генетической дифференциации GST наблюдается в бурзянской локальной популяции GST (0,001), а наибольшая - в иглинской GST (0,026).
На основе изучения полиморфизма 4 микросателлитных локусов были рассчитаны коэффициенты инбридинга F-статистики для всей популяции. Расчет индекса фиксации (Wright, 1965) FIS, отражающего инбридинг особи относительно субпопуляции показал, что во всей популяции наблюдается дефицит гетерозигот FIS (0,052) > 0. Индекс фиксации FIT, отражающий инбридинг особи относительно всей общей популяции, также показал дефицит гетерозигот во всей популяции, но на более высоком уровне FIT (0,163) > 0. Индекс фиксации FST, отражающий инбридинг между субпопуляциями относительно всей целой популяции, а также уровень дифференцированности популяции показал, что популяция в целом подразделена FST (0,117) на субпопуляции.
Индексы фиксации, рассчитанные для субпопуляций были следующие. По значениям FST наименее подразделенной оказалась бурзянская популяция FST (0,001), а наиболее подразделенной иглинская FST (0,028). Наибольший уровень инбридинга и дефицит гетерозигот на уровне субпопуляций FIS и на уровне всей популяции FIT наблюдался в бурзянской популяции FIS (0,241) > 0 и FIT (0,242) > 0, а наименьший - в юсьвенской популяции FIS (0,099) > 0 и FIT (0,115) > 0. В иглинской популяции наблюдался аутбридинг с избытком гетерозигот FIS (-0,167) < 0 и FIT (-0,135) < 0.
На основе стандартных генетических расстояний (Nei, 1978) по данным анализа полиморфизма локуса COI-COII митохондриальной ДНК и микросателлитных локусов ap243, 4a110, a24 и a8 была построена дендрограмма с использованием кластерного анализа методом ближайшего соседа, используя в качестве меры связи метод Варда, а меры расстояния - Евклидову дистанцию. На дендрограмме наблюдается распределение локальных популяций на два кластера, где максимально гибридизованная иглинская популяция группируется отдельно от двух других. Сходная картина распределения локальных популяций наблюдается и в случае анализа только микросателлитных локусов ядерной ДНК.
Проведенный нами анализ генетической структуры трех удаленных друг от друга локальных популяций медоносной пчелы Южного и Среднего Урала показал их генетическую дифференциацию и подразделенность на субпопуляции в целом. Отмечалась совместная группировка юсьвенской популяции медоносной пчелы с бурзянской, которая ранее была определена на основе генетических исследований как популяция среднерусской пчелы Apis mellifera mellifera. Это свидетельствует о происхождении юсьвенской локальной популяции медоносной пчелы по ядерной и митохондриальной ДНК от подвида A.m.mellifera. Ранее определенная на основе генетических исследований гибридная иглинская локальная популяция медоносной пчелы в данном исследовании располагалась отдельно. Следует отметить характерный для большинства популяций медоносной пчелы на Урале небольшой дефицит гетерозигот и инбридинг. Гибридная иглинская популяция, наоборот, характеризуется избытком гетерозигот и аутбридингом. Таким образом, на Южном (Бурзянский район республики Башкортостан) и Среднем Урале (Юсьвенский район Коми-Пермяцкого округа Пермского края) еще сохранились локальные популяции медоносной пчелы подвида A.m.mellifera с достаточными для длительного существования популяции во времени величиной ареала и численности.
We have collected honey bees Apis mellifera out of 43 families with 2 apiaries Reserve Shulgan-Tash Burzyansky district of the republic of Bashkortostan (apiary Kapova-Cave Reserve cordon; apiary p.Koran-Elga) from 52 families with 6 Bashkir apiaries Research Station beekeeping iglinsky district of the republic Bashkortostan (p.Ulu-Telyak, apiary Gareeva; p.Ulu-Telyak, apiary matkovyvodnaya; p.Ulu-Telyak, apiary Orel; p.Ulu-Telyak, apiary Kugeiko; p.Ulu-Telyak, apiary Gromov; p.Ulu -Telyak, apiary Shamsurinskaya) from 37 families with 8 apiaries Yusvenskogo region of Komi-Perm Territory Premyatskogo County (s.Arhangelskoe, apiary Krivoshchekova DF .; s.Yusva, apiary NA Bykov .; s.Pochashor, apiary Storozheva VM .; d.Fedotovo, apiary VD Vlasov .; d.Fedorovo, apiary Boyandina AG d.B.Oni .; apiary, apiary d.Doeg; d.Pozhva apiary). There were analyzed 132 families honeybee.
To study the genetic structure of the honey bee population of the Middle and South Urals, we analyzed the polymorphism locus COI-COII mitochondrial DNA and microsatellite loci ap243, 4a110, a24 and a8. The three local populations of the honey bee (Burzyan, Iglinskiy and yusvenskaya) observed the following frequencies alleys.
Intergenic locus COI-COII mtDNA in honeybee represented 4 states, where Q is the only element in the Urals describes the origin of the maternal line of the sub-species of bees from southern regions - Amcaucasica, Amcarnica, Amligustica and others. All other combinations of elements P and Q in the Urals characterize the honeybee subspecies Ammellifera through the maternal line. Burzyan yusvenskaya population and characterized by the highest content of bees originating from Ammellifera through the maternal line.
The level of heterozygosity is one of the main indicators in the population genetic analysis of the bees, which characterizes the value of biological and genetic diversity. For the honeybee population is known that excessive and insufficient heterozygosity lead to adverse events. For the honeybee population is normal, according to the results of our many years of research in Russia peculiar small deficit of heterozygotes (Ilyasov et al., 2008). We have calculated the value of the average observed heterozygosity in a subpopulation of HO and compared it with the average expected heterozygosity in a subpopulation. In the entire population of all the nuclear DNA microsatellite loci deficient heterozygotes HO (0,413) <HS (0.444). Heterozygosity in subpopulations HS (0.444) greater heterozygosity between subpopulations DST (0,039). The value of inter-population genetic differentiation GST for the entire population of a small and close to the value of 0.080.
Indicators of heterozygosity for each local population is also different. The largest deficit of heterozygotes was observed in the local population Iglinsky HO (0,562) <HS (0.469), and the lowest - in yusvenskoy HO (0,347) <HS (0.389). Interpopulation DST smallest component of heterozygosity in Burzyan local population DST (0,000), and the highest - in Iglinsky DST (0,012). Accordingly, the minimum value of the inter-population genetic differentiation is observed in the GST Burzyan local populations GST (0,001), and the highest - in Iglinsky GST (0,026).
Based on the study of polymorphism of 4 microsatellite loci were calculated inbreeding coefficients F-statistic for the entire population. Calculation of the index of fixation (Wright, 1965) FIS, reflecting individual inbreeding relatively subpopulation showed that in the general population there is a deficit of heterozygotes FIS (0,052)> 0. The index of fixation of FIT, which reflects inbreeding individuals relative to the whole general population, also showed a deficit of heterozygotes in the general population but at a higher level FIT (0,163)> 0. Index fixing FST, reflecting inbreeding among subpopulations relative to the entire population of the whole, and the level of differentiation of the population showed that the population as a whole is divided FST (0,117) in the subpopulation.
Fixation index calculated for subpopulations were as follows. At least FST values ​​was subdivided Burzyan population FST (0,001), and the most subdivided Iglinskiy FST (0,028). The highest level of inbreeding and a lack of heterozygotes at subpopulations of FIS and the level of the whole population was observed in the FIT Burzyan population FIS (0,241)> 0 and FIT (0,242)> 0, and the lowest - in yusvenskoy population FIS (0,099)> 0 and FIT (0,115 )> 0. Iglinsky outbreeding population was observed with an excess of heterozygotes FIS (-0,167) <0 and FIT (-0,135) <0.
Based on standard genetic distances (Nei, 1978) according to an analysis of polymorphism locus COI-COII mitochondrial DNA and microsatellite loci ap243, 4a110, a24 and a8 dendrogram was constructed using the cluster analysis method of the nearest neighbor using a connection method as a measure of Ward and measure the distance - Euclidean distance. In the dendrogram observed distribution of local populations into two clusters, where the most hybridized Iglinskiy population is grouped separately from the other two. A similar pattern of distribution of local populations observed in the case of the analysis of only the nuclear DNA microsatellite loci.
Our analysis of the genetic structure of three widely separated local populations of the honey bee South and Middle Urals demonstrated their genetic differentiation and division into sub-population as a whole. There was a joint group yusvenskoy honeybee population with Burzyan, which was previously determined on the basis of genetic research as the population of Central bee Apis mellifera mellifera. This indicates the origin of the local population yusvenskoy honeybee on nuclear and mitochondrial DNA from the subspecies Ammellifera. Previously defined on the basis of genetic studies hybrid Iglinskiy local honeybee population in this study has a separate. It should be noted characteristic of the majority populations of the honey bee in the Urals small deficit of heterozygotes and inbreeding. Hybrid Iglinskiy population, by contrast, is characterized by an excess of heterozygotes and outbreeding. Thus, in the South (Burzyan district of Bashkortostan) and the Middle Urals (Yusvensky region of Komi-Perm district of the Perm region) is still preserved local populations of the honey bee subspecies Ammellifera with enough for a long time the existence of a population the size of the area and population.
  087. Салтыкова Е.С., Гайфуллина Л.Р., Ильясов Р.А., Николенко А.Г. Действие хитозана на индукцию основных антибактериальных пептидов у медоносной пчелы. Материалы Десятой Международной конференции "Современные перспективы в исследовании хитина и хитозана". Нижний новгород. 2010. С. 308-310.  

Проводился анализ изменения экспрессии антимикробных пептидов дефенсин и абецин под влиянием подкормки сахарным сиропом с хитозаном. Было показано увеличение уровня экспрессии генов антимикробных пептидов под влиянием хитозана примерно в 2 раза, что свидетельствует о роли хитозана в организме медоносной пчелы в повышении иммунитета и адаптированности к условиям окружающей среды.
Антимикробные пептиды (АМП) в организме медоносной пчелы играют важную роль в иммунитете и выживаемости. Два наиболее известных из них дефензин и абецин. Нами был проведен ПЦР в режиме реального времени по результатам поставленного эксперимента при однократном кормлении пчел 0,001% раствором хитозана. После кормления пчел экстрагировалась мРНК, на основе которой синтезировалась кДНК для последующей ПЦР в режиме реального времени (ПЦР РВ). Целью нашего эксперимента стала проверка влияния хитозана на уровень экспрессии антимикробных пептидов абецина и дефензина у медоносной пчелы. Ген MGST в эксперименте использовался в качестве контроля, как ген, на экспрессию которого не должно влиять кормление хитозаном.
Нами были получены данные об уровне изменения экспрессии каждого антимикробного пептида в отдельности в двух повторностях. По результатам поставленных экспериментов после кормления пчел хитозаном можно заключить, что уровень экспрессии дефензина имеет тенденцию к увеличению на 142% (P=0,053) в 1 эксперименте и на 96% (P=0,033) во 2 эксперименте. Уровень экспрессии абецина увеличился на 188% (P<0,001) в 1 эксперименте и на 100% (P<0,001) во 2 эксперименте.
Таким образом, можно предположить, что однократное кормления пчел 0,001% раствором хитозана приводит к заметному увеличению уровня экспрессии антимикробных пептидов дефензина (в 2-2,8 раз) и абецина (в 1,9-2,4 раза) в организме медоносной пчелы Apis mellifera mellifera.
Analyzed changes in the expression of antimicrobial peptides of defensin and abetsin influenced by feeding sugar syrup with chitosan. It has been shown to increase the level of gene expression of antimicrobial peptides under the influence of chitosan is about 2 times, indicating that the role of chitosan in the body of the honeybee in improving immunity and adaptability to environmental conditions.
Antimicrobial peptides (AMPs) in the body of the honeybee play an important role in immunity and survival. The two most prominent of these defensin and abetsin. We carried out the PCR in real time from the results of the experiment with a single staged feeding of bees 0.001% solution of chitosan. After feeding, the bees extracted mRNA from which the cDNA was synthesized for subsequent PCR in real time (real-time PCR). The purpose of our experiment was to check the effect of chitosan on the level of expression of antimicrobial peptides and abetsina defensin in the honeybee. MGST gene used in the experiment as a control as the gene for expression of which should not affect feeding chitosan.
We obtained data on the changes in the expression level of each of the antimicrobial peptide separately in duplicate. According to the results of experiments set after feeding bees chitosan it can be concluded that the expression level of defensin tends to increase by 142% (P = 0,053) in one experiment and by 96% (P = 0,033) in the two experiments. The expression level of abetsina increased by 188% (P <0,001) in experiment 1 and 100% (P <0,001) in the 2nd experiment.
Thus, it can be assumed that a single foraging bees 0.001% chitosan solution leads to a marked increase in the level of expression of defensin antimicrobial peptides (in 2-2,8 times) abetsina (a 1.9-2.4-fold) in the body of the honeybee Apis mellifera mellifera.
  088. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Эволюция и филогенетика медоносной пчелы Урала. Материалы международной научной конференции "Проблемы экологии. Чтения памяти профессора М.М.Кожова". Иркутск. 2010. С. 248.  

Для решения вопросов о подвидах медоносной пчелы, биогеографии и филогенетики наиболее удобно сравнительное изучение последовательности региона мтДНК, охватывающего часть второй субъединицы NADH дегидрогеназы (ND2) и тРНК изолейцина (tRNA ILE). В ходе секвенционного анализа амплифицированного фрагмента гена ND2 мтДНК медоносной пчелы была определена его нуклеотидная последовательность со средним размером 688 п.н. Нуклеотид-ные последовательности просеквенированных фрагментов гена ND2 мтДНК пчел были депонированы в международный генбанк NCBI.
На дендрограмме, построенной по результатам сравнения нуклеотидных последовательно-стей фрагмента гена ND2 не наблюдалось большой дифференциации между представителями населений медоносной пчелы A.m.mellifera разных регионов на Урале (Бурзянский, Татышлин-ский, Бирский районы республики Башкортостан и Крсновишерский, Частинский, Нытвенский и Осинский районы Премского края), что является показателем их тесного генетического родства. Представители уральских и европейских популяций A.m.mellifera кластеризовались в одну группу, названную эволюционной ветвью М. Но от ветви М, предложенной F.Ruttner et al. (1988), она отличалась тем, что в ее состав вошел только один единственный подвид - A.m.mellifera.
Большинство представителей африканских подвидов пчел вошли во вторую группу, названную эволюционной ветвью А, по аналогии с F.Ruttner et al. (1988), хотя по составу подвидов наблюдались определенные различия. Эта ветвь разделилась на две подгруппы, объединяющие северо-африканские и южно-африканские подвиды, что сходно с группировкой M.C.Arias, W.S.Sheppard (1996). Однако, в отличие от группировки последних авторов, мы еще наблюдали третью африканскую группу, объединяющую пчел Центральной Африки - Apis mellifera adansonii Latreille из Сенегала и Apis mellifera scutellata Lepeletier из Кении. От основания ветви А отделилась небольшая группа, куда вошли Apis mellifera meda Skorikov из Сирии, Apis mellifera syriaca Buttel-Reepen из Сирии и Apis mellifera lamarckii Cockerell из Египта, названная эволюционной ветвью О. В четвертую многочисленную группу, названную эволюционной ветвью С, вошли пчелы Средиземноморья, Ближнего Востока и Кавказа.
В дальнейшем мы планируем включить в филогенетический анализ население медоносной пчелы Apis mellifera республик Удмуртия и Татарстан, Свердловской и Челябинской областей.
To address questions about the honey bee subspecies, biogeography and phylogeny most convenient comparative study of mtDNA sequences in the region, covering part of the second subunit of NADH dehydrogenase (ND2) and isoleucine tRNA (tRNA ILE). During sekventsionnogo analysis amplified gene fragment ND2 mtDNA honeybee was determined its nucleotide sequence with an average size of 688 bp Nucleotide sequences sequenced gene fragments ND2 mtDNA bees were deposited at an international genebank NCBI.
In the dendrogram constructed by comparing the nucleotide sequence-gene fragment ND2 stey was no big differentiation between the populations of the honey bee Ammellifera different regions of the Urals (Burzyan, Tatyshlin-sky, Birsky districts of the republic of Bashkortostan and Krsnovishersky, Chastinsky, Nytva and Osa region Premskogo Territory), which is an indicator of their close genetic relationship. The representatives of the Ural and European populations Ammellifera clustered into one group called evolutionary branch from the branch M. But M proposed F.Ruttner et al. (1988), it is different in that its composition entered only a single subspecies - Ammellifera.
Most of the African subspecies of bees included in the second group, called evolutionary branch A, by analogy with the F.Ruttner et al. (1988), although the composition of certain subtypes observed differences. This branch was divided into two subgroups, combining North African and South African subspecies, which is similar to grouping MCArias, WSSheppard (1996). However, unlike the latter group of authors, we have seen a third of the African Group combining the Central African bees - Apis mellifera adansonii Latreille from Senegal and Apis mellifera scutellata Lepeletier from Kenya. From the base of the branches and the Division of a small group which included Apis mellifera meda Skorikov Syria, Apis mellifera syriaca Buttel-Reepen from Syria and Apis mellifera lamarckii Cockerell of Egypt, called evolutionary branch A. The fourth largest group, called evolutionary branch C includes bees Mediterranean, the Middle East and the Caucasus.
In the future, we plan to include in the phylogenetic analysis of the population of the honeybee Apis mellifera republics of Udmurtia and Tatarstan, Sverdlovsk and Chelyabinsk regions.
  089. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Молекулярная характеристика населения медоносной пчелы центральной части республики Башкортостан на основе анализа микросателлитных локусов // Экологический мониторинг и биоразнообразие. Т.5. №1. 2010. C 65-68.

В работе нами были проанализированы медоносные пчелы из 32 семей Иглинского района (3 пасеки: с.Улу-Теляк, пасека Кугейко; с.Улу-Теляк, пасека Громова; с.Улу-Теляк, БОСП, пасека матковыводная), 17 семей Альшеевского района (3 пасеки: с.Никифарово, пасека Юсуповой Р.; с.Раевка, пасека Пискарева М.П.; с.Раевка, пасека Селезнева Б.), 51 семьи Бирского района (10 пасек: д. Угузево, пасека Сафина А.Ф.; г.Бирск, пасека Черенкова В.С.; г.Бирск, пасека Сайфутдинова Е.В.; д.Осиновка, пасека Черникова Ю.П.; д.Акуди, пасека Яикбаева А.А.; д.Печенкино, пасека Габитова И.Р.; д.Улеево, пасека Янситова В.В.; д.Кондаковка, пасека Акмурзина Е.Н.; д.Вязовка, пасека Лепустина И.А.; д.Бахтыбаево, пасека Кутлусатова М.П.), собранные в период 2004-2008 гг. Всего нами были проанализированы медоносные пчелы из 100 семей пчел трех районов центральной части республики Башкортостан (Иглинский, Альшеевский и Бирский). В популяционном анализе были использованы 4 микросателлитных локуса Ap243, 4a110, A24, A8 (Estoup et al., 1995; Solignac et al. 2003). По наблюдаемой частоте аллелей были рассчитаны генетические расстояния Cavalli-Sforza, Edwards (1967) (Табл. 1) и построена дендрограмма (Рис. 1). Население медоносной пчелы Альшеевского района на дендрограмме располагается отдаленно от двух других популяций, что свидетельствует о преобладании потока генов между населениями медоносной пчелы Иглинского и Бирского районов над потоком между каждым из вышеназванных населений и населением Альшеевского района. Население медоносной пчелы Иглинского и Бирского районов ранее по митохондриальной ДНК были отнесены к гибридным и среднерусским A.m.mellifera, соответственно, и их совместная группировка произошла благодаря вкладу северной популяции башкирской медоносной пчелы в создание населения пчел Иглинского района. Кроме того, произошедший завоз семей пчел из гибридизованных пасек Иглинского района в Бирский район также мог привести их к генетическому сближению.
По значениям коэффициентов инбридинга Fis, Fit (Табл. 2) в населении медоносной пчелы центральной части республики Башкортостан отмечается преобладание близкородственного скрещивания над отдаленным. А значение коэффициента инбридинга Fst показывает об отсутствии подразделенности – это говорит о высоком уровне миграции населения медоносной пчелы центральной части республики Башкортостан.
Таким образом, население медоносной пчелы центральной части республики Башкортостан характеризуется отсутствием определенной генетической структурированности, преобладанием инбридинга над аутбридингом. Поток генов между населениями медоносной пчелы увеличивается с уменьшением расстояния между ними. Генетическое родство населений медоносной пчелы разных районов обусловлено миграцией семей между ними. Характеристики F-статистики свидетельствуют о максимальном приближении населения медоносной пчелы центральной части республики Башкортостан в целом к равновесному состоянию и о небольшом снижении устойчивости генофонда к внешним воздействиям.
In this paper we analyzed honeybees from 32 families iglinsky district (3 apiary: s.Ulu-Telyak, apiary Kugeiko; s.Ulu-Telyak, apiary Gromov; s.Ulu-Telyak, VSDB, apiary matkovyvodnaya), 17 families Alsheevsky area (3 apiary: s.Nikifarovo, P .; apiary Yusupova s.Raevka, apiary Piskareva MP .; s.Raevka, apiary Seleznev BI), 51 family Birsk area (10 apiaries: d. Uguzevo, apiary Safina A. F .; g.Birsk, apiary VS Cherenkov .; g.Birsk, apiary Sayfutdinova EV .; d.Osinovka, apiary Chernikov YP .; d.Akudi, apiary Yaikbaeva AA d.Pechenkino .; , apiary Gabitova I.R .; d.Uleevo, apiary Yansitova VV .; d.Kondakovka, apiary Akmurzina EH .; d.Vyazovka, apiary Lepustina IA .; d.Bahtybaevo, apiary Kutlusatova MP .) collected in 2004-2008. In total we analyzed honey bees from 100 bee colonies in the three districts of the central part of the republic of Bashkortostan (Iglinskiy, Alsheevsky and Birsky). The population analysis were used 4 microsatellite loci Ap243, 4a110, A24, A8 (Estoup et al., 1995; Solignac et al. 2003). According to the observed allele frequencies were calculated genetic distances Cavalli-Sforza, Edwards (1967) (Table. 1) and is constructed dendrogram (Fig. 1). The population of the honeybee Alsheevsky area on the dendrogram is distant from the other two populations, indicating that the prevalence of gene flow between the populations of the honey bee and Iglinskiy Birsk areas over the flow between each of the above populations and populations Alsheevsky area. The population of the honeybee and Iglinskiy Birsk areas earlier on mitochondrial DNA have been attributed to hybrid and Srednerussky Ammellifera, respectively, and the joint group was due to the contribution of the northern population of the Bashkir honey bee population of bees in creating iglinsky district. In addition, the delivery of which occurred bee colonies hybridized from apiaries iglinsky district Birsk area could also lead them to the genetic convergence.
From the values ​​of coefficients of inbreeding Fis, Fit (Tab. 2) in the honey bee population of the central part of the republic of Bashkortostan marked predominance of inbreeding on the remote. A coefficient of inbreeding Fst indicates the absence of division - this shows a high level of migration of the honey bee population of the central part of the republic of Bashkortostan.
Thus, the honey bee population of the central part of the Republic of Bashkortostan is characterized by the absence of certain genetic structuring, the prevalence of inbreeding outbreeding. Gene flow between the populations of the honey bee increases with decreasing distance between them. Genetic relatedness honeybee populations of different areas due to migration between the two families. Features F-statistics show extreme close honey bee population of the central part of the Republic of Bashkortostan as a whole to equilibrium and a slight decrease in the stability of the gene pool to external influences.
Microsatellite loci is fine tools in population researches. We analysed honey bees population from 100 colonies of three regions of central part of Bashkortostan republic using microsatellite loci Ap243, 4a110, A24, A8. We shown that honey bee population have not exact structuredness. F-statistics shown little prevalence inbreeding on autbreeding. That characteristics witness about maximal approach to equilibrium condition.
  090. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Генное разнообразие и коэффициенты инбридинга медоносной пчелы в локальной популяции на севере Республики Башкортостан. Материалы всероссийской научно-практической конференции "Полевые и экспериментальные исследования биологических систем". Ишим. 2010. C.66-68.  

Нами были изучены пчелы с 42 пасек трех северных районов (Бирский, Караидельский, Мишкинский). Всего было проанализировано по микросателлитным локусам ар243, 4а110 и А8 ядерной ДНК пчел из 211 семей исследуемых районов Республики Башкортостан. В изучаемой выборке пчел нами были рассчитаны F-коэффициенты и гетерозиготность. Использование в анализе F-коэффициентов и гетерозиготностей позволяет наиболее полноценно и всесторонне охарактеризовать популяции и сравнивать их с аналогичными показателями других популяций. Кроме того, эти характеристики позволяют говорить о процессах, происходящих в популяции и прогнозировать дальнейшую динамику популяции. Анализ средних значений последних по микросателлитным локусам ap243, 4a110 и А8 ядерной ДНК (Табл. 1) показал, что популяция северного ареала башкирской пчелы характеризуется низким уровнем генетической дифференциации (FST=0,015) между субпопуляциями, что свидетельствует о возможном единстве происхождения пчел из этих популяций.
Близкие к нулю значения коэффициентов инбридинга (FIS=0,122 и FIT=0,135) и близкие значения наблюдаемой (HО=0,435) и ожидаемых (HS=0,485 и HТ=0,493) показателей гетерозиготности отражают баланс между инбридингом и аутбридингом, как в отдельных субпопуляциях, так и во всей популяции, в целом, а также свидетельствуют о том, что распределение генотипов по всем локусам приближается к равновесному по Харди-Вайнбергу. Такое равновесное состояние дает возможность длительного существования популяции в современных неизменных условиях окружающей среды.
Таким образом, популяция северного ареала башкирской пчелы A.m.mellifera характеризуется отсутствием подразделенности между населениями пчел Бирского, Караидельского и Мишкинского районов. Минимальное отклонение от равновесия Харди-Вайнберга свидетельствует об устойчивости популяции во времени и незначительном влиянии на нее факторов эволюции. Наблюдаемые коэффициенты инбридинга в популяции можно принять за оптимальные равновесные значения, которые сложились в течение продолжительного времени становления северной популяции A.m.mellifera, которые можно использовать в сравнении с другими популяциями.
We have studied bees with 42 apiaries three northern regions (Birsky, Karaidelsky, Mishkinskoye). There were analyzed for microsatellite loci ar243, 4a110 and A8 nuclear DNA of 211 families of bees studied areas of the Republic of Bashkortostan. In our sample of bees we calculated F-ratios and heterozygosity. Using the analysis of F-ratios and heterozygous allows most fully and comprehensively characterize the population, and to compare them with those of other populations. In addition, these characteristics allow us to speak about the processes occurring in the population and to predict the future dynamics of the population. Analysis of the average of the last of microsatellite loci ap243, 4a110 A8 and nuclear DNA (Table. 1) showed that the population of the northern area of ​​the Bashkir bee is characterized by a low level of genetic differentiation (FST = 0,015) between subpopulations, suggesting a possible common origin of these populations of bees .
Near-zero coefficient of inbreeding (FIS = 0,122 and FIT = 0,135) and similar values ​​observed (HO = 0.435) and expected (HS = 0,485 and HT = 0.493) heterozygosity indices reflect a balance between inbreeding and outbreeding, in certain subpopulations, as and in the population as a whole, as well as evidence that the distribution of genotypes at all loci close to the equilibrium of Hardy-Weinberg equilibrium. This equilibrium state allows continued existence of the population in modern constant environmental conditions.
Thus, the population of the northern area of ​​the Bashkir bee Ammellifera characterized by lack of division between the population of bees Birsk, Karaidelskogo and Mishkinsky areas. Minimum deviation from Hardy-Weinberg equilibrium demonstrates the stability of the population in time and insignificant effect on her evolutionary factors. The observed rates of inbreeding in the population can be taken for optimal equilibrium values ​​that have been established for a long time the formation of northern populations Ammellifera, which can be used in comparison with other populations.
  091. Ильясов Р.А., Фахретдинова С.А., Поскряков А.В., Николенко А.Г. Генетическая структура бурзянской популяции медоносной пчелы Apis mellifera mellifera L. Материалы I международных Беккеровских чтений. Волгоград. 2010. С. 46-50.  

Медоносная пчела подвида Apis mellifera mellifera L. является аборигенной для республики Башкортостан. Наиболее известная популяция медоносной пчелы этого подвида - бурзянская, характеризующаяся наличием большого числа бортевых семей. Для сохранения этой пчелы необходима разметка границ ее ареала. В данной работе мы на основе анализа межгенного локуса COI-COII мтДНК, локуса ND2 мтДНК и микросателлитных локусов ap243, 4a110, ap049, a24 ядерной ДНК показали, что популяция до сих пор сохранилась чистопородной, а ее границы, возможно, распространятся за пределы административных границ района на север в сторону Белорецкого района и на юг в сторону Зилаирского района республики Башкортостан. Для бурзянской популяции медоносной пчелы характерен небольшой уровень инбридинга.
Honeybee subspecies Apis mellifera mellifera L. is a native of the Republic of Bashkortostan. The best known of the honey bee population of this subspecies - Burzyan characterized by the presence of a large number of family tree hollow. To save the bees need this marking the boundaries of its range. In this paper, we based on the analysis of intergenic locus COI-COII mtDNA locus ND2 mtDNA and microsatellite loci ap243, 4a110, ap049, a24 nuclear DNA showed that the population is still kept purebred and its boundaries may spread beyond administrative boundaries district north towards the Beloretsk area and south towards Zilair district of Bashkortostan. For Burzyan honeybee populations typical small level of inbreeding.
  092. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Проблемы пчеловодства Республики Башкортостан. Материалы международной научно-практической конференции "Биологические ресурсы". Киров. 2010. С. 73-75.  

ПРОБЛЕМЫ ПЧЕЛОВОДСТВА РЕСПУБЛИКИ БАШКОРТОСТАН Р.А.Ильясов, А.В.Поскряков, А.Г.Николенко
Институт биохимии и генетики Уфимского научного центра РАН 450054, Россия, Башкортостан, г. Уфа, Пр. Октября, 71 e-mail: apismell@hotmail.com
В животноводстве одним из эффективных способов повышения жизнеспособности и продуктивности сельскохозяйственных животных служит скрещивание географически и экологически отдаленных подвидов. При этом получают гетерозисные гибриды, которые по хозяйственным признакам значительно превосходит своих родителей. Этим пользуются и в пчеловодстве, когда продуктивность гибридных пчел выше, чем чистопородных, на 20-40% что отражено в работах А.Ф. Губина (1936), В.В. Алпатова (1945) и М.И. Доморацкого (1948). Такое мнение в свое время дало основание говорить о необходимости внедрения в производство гибридных пчел первого поколения.
Первые плановые работы по качественному улучшению башкирских пчел относились к 1931 году, когда на базе 80 колхозных пасек лесостепной зоны Башкирская зональная опытная станция пчеловодства занялась созданием племенных пасек по разведению пчел среднерусской расы (Дулькин с соавт., 1953, 1959). В эти же годы в Республике Башкортостан приступили к сравнительному испытанию различных подвидов пчел и их гибридизации. По данным Г.А. Аветисяна (1935), гибриды первого поколения местных пчел Apis mellifera mellifera L. с южными подвидами в Республике Башкортостан оказались продуктивнее местных на 49%. А.Ф. Рахимкулов (1960) сообщает, что в условиях среднего медосбора с полевых и лесных медоносов Благовещенского района РБ гибридные пчелы давали на 20-30 кг меда больше, чем местные. А.Н. Биктимиров (1963), наблюдая за работой кавказских пчел Республике Башкортостан в период с 1958 по 1962 год, отметил, что при медосборе с луговых и полевых медоносов гибридные пчелы по продуктивности превосходили местных на 80%, но по зимостойкости уступали последним.
В результате многолетних (1965-1974) опытов по испытанию завозных южных подвидов (кавказские, карпатские, итальянские) пчел и их гибридов в Республике Башкортостан исследователями В.Н. Власовым и Г.К. Косаревым (1980) установлено, что имеются определенные различия в летной и медособирательной работе, развитии и продуктивности семей в зависимости от медосборных условий по природным зонам. Так, в лесостепной и степной зонах гибридные кавказские и итальянские пчелы по нагрузке медового зобика и общему приносу нектара достоверно превышали пчел местного подвида, тогда как при медосборе с липы превосходство наблюдалось у местных пчел среднерусской расы Apis mellifera mellifera. В дальнейшем, в ходе разработки плана породного районирования медоносных пчел СССР в условиях республики Башкортостан проводили сравнительные испытания местных пчел, пчел южных рас и их гибридов (Биктимиров, 1963; Джапаридзе, 1988). В основу данной работы по сравнительной оценке использования рас пчел была положена методика, разработанная научно-исследовательским институтом
пчеловодства (Билаш, 1963). Первый этап испытаний (1965-1968) проводился в Казангуловском опытном хозяйстве Давлекановского района и в колхозе им. Куйбышева Альшеевского района (1967-1968). На втором этапе (1970-1972) испытывали перспективные для степного взятка семьи пчел - гибридов первого поколения (местных с серыми горными кавказскими).
В 1965-1970гг. на Башкирской опытной станции пчеловодства (БОСП) проводились породные испытания гибридов от скрещивания итальянских пчел с местными. По результатам наблюдений они собрали меда на 51% больше, чем местные среднерусские, но последующие поколения гибридов, по сравнению с родительскими особями, не давали положительных результатов. А. А. Юрьев же (1969) отмечал, что привезенные с Кавказа на Урал пчелы по медо- и воскопродуктивности не превосходили местных и уступали им по зимостойкости .
Однако позже стало известно, что гетерозис проявляется не при любых скрещиваниях пчел и зависит от направления скрещивания (Жданов, 1970; Бородачев и Бородачева, 1982). Уменьшение жизнеспособности и
продуктивности гибридных пчел является результатом гибридного дисгенеза. Бесконтрольная гибридизация пчел среднерусской расы с южными, чувствительными к низким температурам, подвидами пчел является одной из основных причин гибели и ослабления пчелиных семей в зимне-весенний период и одной из важнейших проблем пчеловодства (Черевко, Черевко, 1998). За последние двадцать лет в республике Башкортостан почти ежегодно принимались программы по сохранению башкирской пчелы Apis mellifera mellifera. Однако генофонд башкирской пчелы продолжал находиться в состоянии глубокой гибридизации. Ежегодно в республике Башкортостан погибало не менее 8-10% всех семей, т.е. около 15-20 тысяч (Косарев, 1989).
Скоро неудачный эксперимент по массовому улучшению аборигенных подвидов пчел был прерван. В 1958 году организован Прибельский филиал Башкирского заповедника по сохранению аборигенных бортевых пчел (Тахаев, 1959). В 1986 г. он был преобразован в самостоятельный заповедник «Шульган- Таш». Заповедник расположен на юге Республики Башкортостан в пределах Бурзянского административного района, и по своему географическому положению относится к Центральному горному району Южного Урала. Заповедник находится в западной части данного района, имеет сложную вытянутую конфигурацию границ, расположен между реками Белая и Нугуш в пределах 5300Г-53015’ с.ш. и 56053,-57007’ в.д. Протяженность территории с севера на юг составляет 26 км, с запада на восток - 15 км, а общая площадь составляет 22531 га.
В 1959 г. в России были приняты меры по охране A.m.mellifera. По решению Технического совета Министерства сельского хозяйства РСФСР от 20 октября 1959 году была запрещена интродукция пчел из южных районов в северные - Сибирь и Урал. В 1974-1983 годы БОСП занималась проблемой массовой репродукции маток. Ими были разработаны технологии репродукции маток, которые испытывались в 10 хозяйствах республики, а также созданы 4 специализированные пасеки в крупных пчелосовхозах с объемом воспроизводства 28-32 тыс. чистопородных неоплодотворенных маток за сезон.
Также за период с 1981 по 1985 гг. БОСП были проведены экспедиции по территории Республики Башкортостан с целью поиска и завоза лучших семей башкирской популяции среднерусской расы на территорию Иглинского района для создания племенных пасек. За этот период на станцию было завезено более 200 семей, организованы 2 племенные пасеки и начаты работы по аналитической селекции (Газизов, 1987).
Сохранению бортевых пчелиных семей в условиях Бурзянского района благоприятствовали климатические условия и хорошая естественная кормовая база - большие массивы липы, клена, ивы и разнообразная травянистая медоносная растительность. Бурзянский район является одним из самых отдаленных и изолированных в Республике Башкортостан. Долгое время туда практически не было проложено хороших дорог и этот район до сих пор остается самым малозаселенным в Республике. Его изоляции способствует также расположение в горно-лесной зоне Южного Урала. В гористой местности Бурзянского района конец цветения одного растения на южном склоне совпадает с началом цветения на северном склоне. На протяжении 200-210 дней суровой зимы с морозами, нередко достигающими 45°С, семьи чувствуют себя нормально, весной в них бывает небольшое количество подмора. Бортевые пчелы меньше страдают от пади в зимних кормах по сравнению с пчелами, которые находятся в зимовниках. Очистительный облет весной они делают раньше и при более низкой температуре (Шакиров, 1992; Власов, 1996).
В период 2000-2009 гг. наша лаборатория в составе института биохимии и генетики Уфимского научного центра РАН проводила молекулярногенетические исследования медоносной пчелы в республике Башкортостан. В основу метода исследования был заложен полиморфизм микросателлитных локусов ядерной ДНК и некоторых локусов мтДНК (Ильясов с соавт., 2007). Мы показали, что на территории республики Башкортостан еще сохранилось несколько больших массивов населения медоносной пчелы среднерусской расы Apis mellifera mellifera. На данный момент один из них занимает обширную северную область республики, другой - горную юго-восточную область республики Башкортостан. Следует отметить, что население пчел северной области значительно превосходит по распространенности население пчел юговосточной горной области. Кроме того, имеется очень прерывистый ареал Apis mellifera mellifera в центральных и западных областях республики Башкортостан. С большой уверенностью можно сказать, что население пчел юго-восточной горной области относится к популяционной системе, тогда как население пчел других областей - к метапопуляции. Таким образом, республика Башкортостан на современном этапе развития обладает мощным резервным потенциалом для восстановления популяции аборигенных среднерусских пчел в ареалах, разорванных процессом гибридизации как на собственной территории, так и территории других северных регионов.
BEE PROBLEMS BASHKORTOSTAN R.A.Ilyasov, A.V.Poskryakov, A.G.Nikolenko
Institute of Biochemistry and Genetics, Ufa Scientific Center, RAS 450054, Russia, Bashkortostan, Ufa, pr. Oct. 71 e-mail: apismell@hotmail.com
In animal an effective way to improve the viability and productivity of farm animals is a crossing of geographically remote and environmentally subspecies. This produces heterosis hybrids that on economic grounds far exceeds their parents. This is used in beekeeping when the productivity of hybrid bee higher than pure-bred, by 20-40%, which is reflected in the works of AF Gubin (1936), VV Alpatov (1945) and MI Domoratskogo (1948). Such an opinion at the time gave reason to talk about the need to introduce in the production of hybrid of the first generation of bees.
The first plan of work for the qualitative improvement of the Bashkir bees belonged to 1931, when on the basis of collective 80 apiaries steppe zone Bashkir zonal experimental station of beekeeping engaged in the creation of breeding apiaries for breeding bees of Central Race (Dulkin et al., 1953, 1959). In the same years in the Republic of Bashkortostan started to comparative tests of different subspecies of bees and their hybridization. According to GA Avetisyan (1935), the first generation hybrids local bee Apis mellifera mellifera L. from southern subspecies in the Republic of Bashkortostan have been productive local 49%. AF Rakhimkulov (1960) reports that in the average honey yield from field and forest honey plants Annunciation district RB hybrid bees gave 20-30 kg of honey more than local. AN Biktimirov (1963), observing the work of the Caucasian bees Republic of Bashkortostan in the period from 1958 to 1962, noted that the honey harvest with meadow and field hybrid bee honey plants on the productivity of local superior for 80%, but conceded last winter hardiness.
As a result of long-term (1965-1974) experiments on testing imported southern subspecies (Caucasus, Carpathian, Italian) of bees and their hybrids in the Republic of Bashkortostan researchers VN Vlasov and GK Kosarev (1980) found that there are certain differences in summer and medosobiratelnoy work, development and productivity of families depending on medosbornyh conditions of natural areas. Thus, in the forest-steppe and steppe zones of hybrid Caucasian and Italian bees on honey zobika load and brings the total of nectar bees significantly exceed the local subspecies, whereas with linden honey yield superiority was observed in native bees of Central race Apis mellifera mellifera. Later, during the development of the breed regionalization plan honeybees USSR in the Republic of Bashkortostan conducted comparative tests of native bees, bees southern races and their hybrids (Biktimirov, 1963; Japaridze, 1988). This paper is based on the comparative assessment of the races of bees were based on a procedure developed by a research institute
Beekeeping (Bilash, 1963). The first stage of testing (1965-1968) was held in Kazangulovskom Davlekanovskiy experimental farm area and the farm to them. Alsheevsky Kuibyshev district (1967-1968). In the second phase (1970-1972) experienced perspective to bribe steppe family of bees - the first generation hybrids (local gray mountain Caucasian).
In 1965-1970gg. Bashkir Bee Research Station (VSDB) tests were conducted breed hybrids by crossing Italian bees with the locals. According to the results of observations of honey they collected 51% more than the local Central Russian, but the next generation of hybrids compared with parental individuals, did not give positive results. A. Yuryev same (1969) noted that imported from the Caucasus to the Ural bee on medo- voskoproduktivnosti and do not exceed local and inferior to them in winter hardiness.
However, later it became known that heterosis is manifested not in any crosses bees and depends on the direction crossing (Zhdanov, 1970; bearded Borodacheva, 1982). Reducing the viability and
productivity is a result of hybrid bees hybrid dysgenesis. Uncontrolled hybridization bees of Central race with southern sensitive to low temperatures, bee subspecies is one of the major causes of death and the weakening of bee colonies in winter and spring, and one of the major problems of beekeeping (Cherevko, Cherevko, 1998). Over the past twenty years in the Republic of Bashkortostan adopted almost every year of the program for the conservation of Bashkir bee Apis mellifera mellifera. However, the gene pool of the Bashkir bee continued to be in a state of deep hybridization. Every year in the republic of Bashkortostan perished at least 8-10% of all families, ie 15-20 thousand (Kosarev, 1989).
Soon the failed experiment of massive improvement subspecies native bees was interrupted. In 1958 he organized a branch of the Bashkir Pribelsky reserve on conservation of native wild-hive bee (Taha 1959). In 1986 it was transformed into an independent reserve "Shulgan- Tash." The reserve is located in the south of the Republic of Bashkortostan within Burzyansky Administrative Region, and its geographical location refers to the central highlands of the Southern Urals. The reserve is located in the western part of the region, it has a complex configuration of the extended boundaries, located between the rivers White and Nugush within 5300G-53015 'N and 56053, -57007 'E. The length of the territory from north to south is 26 km, from west to east - 15 km and a total area of ​​22531 hectares.
In 1959, Russia adopted measures to protect Ammellifera. According to the decision of the Technical Council of the Ministry of Agriculture of the Russian Federation dated 20 October 1959, prohibited the introduction of bees from southern to northern - Siberia and the Urals. In 1974-1983 years he worked VSDB problem of mass reproduction of queens. They have developed technology of reproduction of queens, which were tested in 10 farms of the republic, as well as create 4 specialized in large apiary pchelosovhozah with a volume of 28-32 thousand reproduction. Infertile thoroughbred mares per season.
Also, for the period from 1981 to 1985. VSDB expeditions were conducted on the territory of the Republic of Bashkortostan for the purpose of search and delivery of the best families of the Bashkir population of the territory of Central race iglinsky district to create a breeding apiaries. During this period, the station was brought more than 200 families, organized two tribal apiary and started work on analytical selection (Gazizov, 1987).
Conservation of wild-hive bee colonies under Burzyansky district favored climatic conditions and good natural food supply - large amounts of lime, maple, willow and diverse herbaceous vegetation honey. Burzyan area is one of the most remote and isolated in the Republic of Bashkortostan. For a long time there was virtually no good roads paved and the area still remains the most sparsely populated in the country. It also contributes to the isolation location in the mountain forest zone of Southern Urals. In mountainous terrain Burzyansky district end of flowering plants on the southern slope coincides with the beginning of flowering on the northern slope. For 200-210 days of severe winter frosts, often reaching 45 ° C, the family feel good spring in them is a small amount of Podmore. Wild-hive bee suffer less from winter fodder paddy compared to bees that are in Zimovniki. Cleansing circled the spring before they do, and at a lower temperature (Shakirov, 1992; Vlasov, 1996).
In the period 2000-2009. our laboratory in the Institute of Biochemistry and Genetics, Ufa Scientific Center, Russian Academy of Sciences conducted research molekulyarnogeneticheskie honeybee in the Republic of Bashkortostan. The basis of the research method was laid polymorphism of microsatellite loci of nuclear DNA and mtDNA of some loci (Ilyasov et al., 2007). We have shown that in the territory of the Republic of Bashkortostan has survived several large arrays of honeybee populations of Central race Apis mellifera mellifera. At the moment, one of them is a vast northern region of the republic, the other - a mountain south-eastern area of ​​the Republic of Bashkortostan. It should be noted that the population of bees the northern region is significantly superior to the prevalence of the population of bees southeastern mountain region. In addition, there is a very intermittent area Apis mellifera mellifera in the central and western regions of the Republic of Bashkortostan. With great confidence we can say that the bee population of the southeastern mountain region refers to the system of population, whereas the population of bees other areas - a metapopulation. Thus, the Republic of Bashkortostan at the present stage of development has a powerful backup capabilities for restoring populations of native bees in Central Russia resorts, broken hybridization process on its own territory, and in other northern regions.
  093. Ильясов Р.А., Петухов А.В., Поскряков А.В., Николенко А.Г. Оценка популяционно-генетической структуры населения медоносной пчелы Среднего и Южного Урала. Международная конференция "Пчеловодство – XXI век". Москва. 2010. С. 55-59.  

Для изучения генетической структуры населения медоносной пчелы Среднего и Южного Урала мы анализировали полиморфизм локуса COI-COII митохондриальной ДНК и микросателлитных локусов ap243, 4a110, a24 и a8. В трех локальных популяциях медоносной пчелы (бурзянская, иглинская и юсьвенская) наблюдались следующие частоты аллей (табл.1).
Межгенный локуса COI-COII мтДНК у медоносной пчелы представлен 4 состояниями, где единственный элемент Q на Урале характеризует происхождение по материнской линии от подвидов пчел из южных регионов - A.m.caucasica, A.m.carnica, A.m.ligustica и других. Все остальные комбинации элементов P и Q на Урале характеризуют медоносную пчелу подвида A.m.mellifera по материнской линии. Как показывает таблица 2, бурзянская и юсьвенская популяции характеризуются максимальным содержанием пчел, происходящих от A.m.mellifera по материнской линии.
Уровень гетерозиготности является одним из основных показателей в популяционногенетическом анализе пчел, характеризующий величину биологического и генного разнообразия. Для популяции медоносной пчелы известно, что избыточная и недостаточная гетерозиготность ведет к неблагоприятным явлениям. Для популяции медоносной пчелы в норме, по результатам наших многолетних исследований в России, свойственен небольшой дефицит гетерозигот (Ильясов с соавт., 2008).
Мы рассчитали величину средней наблюдаемой гетерозиготности внутри субпопуляции HO (табл. 1) и сравнили ее со средней ожидаемой гетерозиготностью внутри субпопуляции. Во всей популяции по всем микросателлитным локусам ядерной ДНК наблюдается дефицит гетерозигот. Гетерозиготность внутри субпопуляций Н больше гетерозиготности между субпопуляциями DST. Величина межпопуляционной генетической дифференциации GST для всей популяции небольшая и приближается к 0,1.
Показатели гетерозиготности (табл. 3) для каждой локальной популяции также
различались. Наибольший дефицит гетерозигот наблюдался в иглинской локальной популяции, а наименьший - в бурзянской. Межпопуляционная составляющая гетерозиготности DST наименьшая в бурзянской локальной популяции, а наибольшая - в иглинской. Соответственно, наименьшая величина межпопуляционной генетической дифференциации GST наблюдается в бурзянской локальной популяции, а наибольшая - в иглинской.
На основе изучения полиморфизма 4 микросателлитных локусов были рассчитаны коэффициенты инбридинга F-статистики для всей популяции (табл. 4). Расчет индекса фиксации (Wright, 1965) FiS, отражающего инбридинг особи относительно субпопуляции показал, что во всей популяции наблюдается дефицит гетерозигот. Индекс фиксации FiT, отражающий инбридинг особи относительно всей общей популяции, также показал дефицит гетерозигот во всей популяции, но на более высоком уровне. Индекс фиксации FST, отражающий инбридинг между субпопуляциями относительно всей целой популяции, а также уровень дифференцированности популяции показал, что популяция в целом подразделена на субпопуляции.
Индексы фиксации, рассчитанные для субпопуляций были следующие (табл. 5). По значениям FST наименее подразделенной оказалась бурзянская популяция, а наиболее подразделенной иглинская. Наибольший уровень инбридинга и дефицит гетерозигот на уровне субпопуляций FiS и на уровне всей популяции FiT наблюдался в бурзянской популяции, а наименьший - в юсьвенской популяции. В иглинской популяции наблюдался аутбридинг с избытком гетерозигот.
На основе стандартных генетических расстояний (Nei, 1978) по данным анализа полиморфизма локуса COI-COII митохондриальной ДНК и микросателлитных локусов ap243, 4a110, a24 и a8 была построена дендрограмма (рис. 1) с использованием кластерного анализа методом ближайшего соседа, используя в качестве меры связи метод Варда, а меры расстояния - Евклидову дистанцию. На дендрограмме наблюдается распределение локальных популяций на два кластера, где максимально гибридизованная иглинская популяция группируется отдельно от двух других. Сходная картина распределения локальных популяций наблюдается и в случае анализа только микросателлитных локусов ядерной ДНК.
Проведенный нами анализ генетической структуры трех удаленных друг от друга локальных популяций медоносной пчелы Южного и Среднего Урала показал их генетическую дифференциацию и подразделенность на субпопуляции в целом. Отмечалась совместная группировка юсьвенской популяции медоносной пчелы с бурзянской, которая ранее была определена на основе генетических исследований как популяция среднерусской пчелы Apis mellifera mellifera. Это свидетельствует о происхождении юсьвенской локальной популяции медоносной пчелы по ядерной и митохондриальной ДНК от подвида A.m.mellifera. Ранее определенная на основе генетических исследований гибридная иглинская локальная популяция медоносной пчелы в данном исследовании располагалась отдельно. Следует отметить характерный для большинства популяций медоносной пчелы на Урале небольшой дефицит гетерозигот и инбридинг. Гибридная иглинская популяция, наоборот, характеризуется избытком гетерозигот и аутбридингом. Таким образом, на Южном (Бурзянский район республики Башкортостан) и Среднем Урале (Юсьвенский район Коми-Пермяцкого округа Пермского края) еще сохранились локальные популяции медоносной пчелы подвида A.m.mellifera с достаточными для длительного существования популяции во времени величиной ареала и численности.
To study the genetic structure of the honey bee population of the Middle and South Urals, we analyzed the polymorphism locus COI-COII mitochondrial DNA and microsatellite loci ap243, 4a110, a24 and a8. The three local populations of the honey bee (Burzyan, Iglinskiy and yusvenskaya) observed the following frequencies alleys (Table 1).
Intergenic locus COI-COII mtDNA in honeybee represented 4 states, where Q is the only element in the Urals describes the origin of the maternal line of the sub-species of bees from southern regions - Amcaucasica, Amcarnica, Amligustica and others. All other combinations of elements P and Q in the Urals characterize the honeybee subspecies Ammellifera through the maternal line. As shown in Table 2, and Burzyan yusvenskaya populations are characterized by the highest content of bees originating from Ammellifera through the maternal line.
The level of heterozygosity is one of the main indicators in the analysis populyatsionnogeneticheskom bees characterizing the magnitude of the biological and genetic diversity. For the honeybee population is known that excessive and insufficient heterozygosity lead to adverse events. For the honeybee population is normal, according to the results of our many years of research in Russia peculiar small deficit of heterozygotes (Ilyasov et al., 2008).
We have calculated the value of the average observed heterozygosity in a subpopulation of HO (Table. 1) and compared it with the average expected heterozygosity in a subpopulation. In the entire population of all the nuclear DNA microsatellite loci deficient heterozygotes. Heterozygosity in subpopulations N greater heterozygosity between subpopulations DST. The value of inter-population genetic differentiation GST for the entire population of a small and close to 0.1.
Indicators of heterozygosity (Table. 3) for each of the local population and
different. The largest deficit was observed in heterozygotes Iglinsky local population, and the lowest - in Burzyan. Interpopulation DST smallest component of heterozygosity in Burzyan local population, and the largest - in Iglinsky. Accordingly, the minimum value of the inter-population genetic differentiation is observed in the GST Burzyan local population, and the largest - in Iglinsky.
Based on the study of polymorphism of 4 microsatellite loci were calculated inbreeding coefficients F-statistic for the entire population (tab. 4). Calculation of the index of fixation (Wright, 1965) FiS, reflecting individual inbreeding relatively subpopulation showed that in the general population there is a deficit of heterozygotes. Index fixing FiT, reflecting inbreeding individuals relative to the whole general population, also showed a deficit of heterozygotes in the general population, but at a higher level. Index fixing FST, reflecting inbreeding among subpopulations relative to the entire population of the whole, and the level of differentiation of the population showed that the population as a whole is subdivided into subpopulations.
Fixation index calculated for subpopulations were as follows (Table. 5). At least FST values ​​was subdivided Burzyan population, most subdivided Iglinskiy. The highest level of inbreeding and a lack of heterozygotes at subpopulations FiS at the level of the entire population FiT Burzyan observed in the population, and the lowest - in yusvenskoy population. In Iglinsky outbreeding populations observed excess of heterozygotes.
Based on standard genetic distances (Nei, 1978) according to an analysis of polymorphism locus COI-COII mitochondrial DNA and microsatellite loci ap243, 4a110, a24 and a8 dendrogram was constructed (Fig. 1) using the cluster analysis method of the nearest neighbor using as measures Ward's method of communication, and measures the distance - Euclidean distance. In the dendrogram observed distribution of local populations into two clusters, where the most hybridized Iglinskiy population is grouped separately from the other two. A similar pattern of distribution of local populations observed in the case of the analysis of only the nuclear DNA microsatellite loci.
Our analysis of the genetic structure of three widely separated local populations of the honey bee South and Middle Urals demonstrated their genetic differentiation and division into sub-population as a whole. There was a joint group yusvenskoy honeybee population with Burzyan, which was previously determined on the basis of genetic research as the population of Central bee Apis mellifera mellifera. This indicates the origin of the local population yusvenskoy honeybee on nuclear and mitochondrial DNA from the subspecies Ammellifera. Previously defined on the basis of genetic studies hybrid Iglinskiy local honeybee population in this study has a separate. It should be noted characteristic of the majority populations of the honey bee in the Urals small deficit of heterozygotes and inbreeding. Hybrid Iglinskiy population, by contrast, is characterized by an excess of heterozygotes and outbreeding. Thus, in the South (Burzyan district of Bashkortostan) and the Middle Urals (Yusvensky region of Komi-Perm district of the Perm region) is still preserved local populations of the honey bee subspecies Ammellifera with enough for a long time the existence of a population the size of the area and population.
  094. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Partial sequencing analysis of gene ND2 honeybee Apis mellifera caucasica from Krasnaya polyana of Krasnodarskii region of Russia. GenBank. 2010. accession numbers HQ318729-HQ318730 (http://www.ncbi.nlm.nih.gov).  

Apis mellifera caucasica bio-material 3692 NADH dehydrogenase subunit 2 (ND2) gene, partial cds; mitochondrial
GenBank: HQ318730.1
LOCUS HQ318730 540 bp DNA linear INV 22-FEB-2011
DEFINITION Apis mellifera caucasica bio-material 3692 NADH dehydrogenase
subunit 2 (ND2) gene, partial cds; mitochondrial.
ACCESSION HQ318730
VERSION HQ318730.1 GI:323522307
KEYWORDS .
SOURCE mitochondrion Apis mellifera caucasica (Caucasian honeybee)
ORGANISM Apis mellifera caucasica
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;
Neoptera; Endopterygota; Hymenoptera; Apocrita; Aculeata; Apoidea;
Apidae; Apis.
REFERENCE 1 (bases 1 to 540)
AUTHORS Ilyasov,R.A., Nikolenko,A.G. and Poskryakov,A.V.
TITLE Partial sequencing analysis of gene ND2 honeybee Apis mellifera
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 540)
AUTHORS Ilyasov,R.A., Nikolenko,A.G. and Poskryakov,A.V.
TITLE Direct Submission
JOURNAL Submitted (23-SEP-2010) Ufa Scientific Center of Russia Academy of
Sciences, Institute of Biochemistry and Genetics, Prospect
Octyabrya, Ufa, Bashkortostan 450054, Russia
FEATURES Location/Qualifiers
source 1..540
/organism="Apis mellifera caucasica"
/organelle="mitochondrion"
/mol_type="genomic DNA"
/isolation_source="Krasnaya Polyana apiary colony 2"
/sub_species="caucasica"
/bio_material="3692"
/db_xref="taxon:200407"
/country="Russia: Krasnodarskii region"
gene 25..>540
/gene="ND2"
CDS 25..>540
/gene="ND2"
/codon_start=1
/transl_table=5
/product="NADH dehydrogenase subunit 2"
/protein_id="ADX94781.1"
/db_xref="GI:323522308"
/translation="MFFMNFKYHWFIYLLITIFVLMMNSNNIFIQWMLMEFGTIISIS
LINIKSTNKTPSLIYYSVSVISSIFLFFMIIVYLSSISFIKTDTFNFMVQMMFFLKIG
TFPFHFWMIYSYEMMNWKQIFLMSTLIKFIPIYMMVSMTKINSWTLYFLITNSLYISF
YANKFYTLKKLL"
ORIGIN
1 aattttatat atatactatt acttatcttc ttcataaatt ttaaatacca ctgatttatt
61 tatcttttaa ttactatttt tgtattaata ataaattcca ataatatttt tattcaatga
121 atattaatag aatttggtac aatcattaga attagattaa ttaatattaa atccacaaat
181 aaaaccccaa gattaattta ttattcagta tcagtaattt caagaatttt tttattcttt
241 ataattattg tatacttatc atccattaga tttattaaaa cagatacttt taattttata
301 gttcaaataa tatttttttt aaaaattgga actttcccct ttcatttttg aataatttat
361 tcttatgaaa taataaattg aaagcaaatt tttttaatat caacattaat taaatttatt
421 ccaatttata taatagtttc aataactaaa attaattcat gaacattata ttttttaatt
481 acaaatagat tatatatttc attttatgct aataaatttt acactctaaa aaaattacta
//
  095. Пискарева Е. М., Ильясов Р. А., Поскряков А. В., Николенко А. Г. Проблемы сохранения среднерусской расы пчел в республике Башкортостан. Материалы Всероссийской научно-практической конференции "Актуальные проблемы изучения биоты Южного Урала и сопредельных территорий". Орск. 2010. С. 55-57.  

Перемещение медоносных пчел (Apis mellifera L.) из одних биоклиматических зон в другие и вызванная этим гибридизация привели к тому, что на месте естественно сложившихся местных популяций сформировались помеси неизвестного происхождения. Изучение их генетических характеристик позволит выявить резервные очаги местообитания Apis mellifera mellifera пчелы среднерусской (Ильясов с соавт., 2008).
В связи с возрастанием уровня гибридизации популяций A.m.mellifera в России возможность полного исчезновения генофонда этого подвида становится все большей реальностью. Факт того, что в условиях глобальной гибридизации пчел еще сохранились не подверженные гибридизации популяции A.m.mellifera, послужил некоторым толчком к деятельности по сохранению и восстановлению генофонда популяций A.m.mellifera в России как наиболее целесообразного подвида для разведения в климатических условиях России (Ильясов с соавт., 2010).
Морфометрические исследования были малопригодны для идентификации A.m.mellifera в условиях гибридизации, и только с введением молекулярногенетических методов удалось доказать, что отдельные популяции A.m.mellifera все же сохранились. Изучение и сохранение биоразнообразия являются одной из ключевых задач современной экологии. Успешная охрана биоразнообразия, как условие сохранения устойчивости экосистем и биосферы в целом, возможно только на основе всестороннего изучения составляющих ее видов и популяций (Прокофьева, 2004). Для изучения мы взяли 3 популяции пчел из Альшеевского района республики Башкортостан. Результаты анализировались сравнительно с результатами по анализу популяций пчел Красновишерского р-на Пермского края, ранее определенные как A.m.mellifera, и популяций пчел Красноуфимского р-на Свердловской обл., ранее определенные как гибридные популяции (Ильясов с соавт., 2006).
Нами был изучен полиморфизм микросателлитных локусов ap243, 4a 110, a24, a8, a43, a113, ap049 ядерной ДНК и полиморфизм локуса COI-COII мтДНК. По результатам анализа частот аллелей локусов были получены генетические расстояния, на основе которых кластерным анализом методом ближайшего соседа была построена дендрограмма генетических отношений населений пчел изучаемых нами популяций. Дендрограммы были построены отдельно по микросателлитным локусам и отдельно с использованием локусов ядерной и митохондриальной ДНК.
По результатам анализа межгенного локуса COI-COII мтДНК пасеки северной части района оказалась полностью гибридной (частота маркера для
A.m.mellifera PQQ=0%), пасеки центральной части района - гибридная наполовину (частота PQQ=60%), пасеки южной части района - семьи пчел имеют происхождение от Apis mellifera mellifera по материнской линии (частота PQQ=100%).
По результатам анализа микросателлитных локусов яДНК (4А110, ар243, ар049, А24, А8, А43, А113) и межгенного локуса COI-COII мтДНК пасеки северной части района группируются с пасеками Свердловской области, что говорит о их гибридном происхождении, пасеки южной части района группируется с пасекой Пермского края, что говорит о происхождении от Apis mellifera mellifera , а пасеки центральной части района находятся между первой и второй группой, что говорит о их большой степени гибридизации.
Такое расположение можно объяснить тем, что в популяции пчел Альшеевского района республики Башкортостан гибридизация шла в большей степени по отцовской линии, чем по материнской.
Move the honey bee (Apis mellifera L.) from one bioclimatic zones in the other and the resulting hybridization has led to that in place of the existing local populations naturally formed hybrids of unknown origin. The study of their genetic characteristics will reveal reserve pockets of habitat Apis mellifera mellifera bees of Central (Ilyasov et al., 2008).
In connection with the increase in the level of hybridization Ammellifera populations in Russia to the complete disappearance of the gene pool of this subspecies is becoming more real. The fact that in the global hybridization of bees still remain not subject to hybridization population Ammellifera, served as the impetus for some of the conservation and restoration of the gene pool of populations Ammellifera in Russia as the most appropriate sub-species breeding in the climate conditions of Russia (Ilyasov et al., 2010 ).
The morphometric studies were of little use for identification Ammellifera in hybridization conditions, and only with the introduction of molekulyarnogeneticheskih methods failed to prove that the individual populations Ammellifera still preserved. The study and conservation of biodiversity is one of the key problems of modern ecology. Successful protection of biodiversity, as a condition of preservation of stability of ecosystems and the biosphere as a whole, can only be based on a comprehensive study of its constituent species and populations (Prokofiev, 2004). For the study, we took 3 of the bee population Alsheevsky district of Bashkortostan. The results were analyzed in comparison with the results of analysis of bee populations Krasnovishersky district of the Perm region, previously defined as Ammellifera, and bee populations Krasnoufimsky district of Sverdlovsk region., Previously defined as hybrid populations (Ilyasov et al., 2006).
We have studied the polymorphism of microsatellite loci ap243, 4a 110, a24, a8, a43, a113, ap049 nuclear DNA polymorphism locus COI-COII mtDNA. According to the analysis of allele frequencies loci were obtained genetic distances, based on which the cluster analysis method the nearest neighbor was constructed dendrogram of genetic relationship bee populations we studied populations. Dendrogram were constructed separately for microsatellite loci and loci separately using nuclear and mitochondrial DNA.
According to the analysis of intergenic locus COI-COII mtDNA apiary northern part of the district was completely hybrid (frequency marker for
Ammellifera PQQ = 0%), the central part of the apiary - a hybrid half (frequency PQQ = 60%), the southern part of apiaries - bee colonies are derived from Apis mellifera mellifera maternal (frequency PQQ = 100%).
According to the analysis of nuclear DNA microsatellite loci (4A110, ar243, ar049, A24, A8, A43, A113) and intergenic locus COI-COII mtDNA apiary northern part of the apiaries are grouped with the Sverdlovsk region, indicating that their hybrid origin, the apiary southern region grouped apiary with the Perm region, indicating that the origin of Apis mellifera mellifera, and the central part of the apiary located between the first and second group, indicating their high degree of hybridization.
This arrangement may be explained by the fact that the population of bees Alsheevsky district of Bashkortostan hybridization was largely paternal than maternal.
  096. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Популяционная генетика медоносной пчелы центральной части республики Башкортостан и анализ таксономии подвидов. Материалы Всероссийской научно-практической конференции "Мир пчел". Ижевск. 2011. С. 51–57.

Нами был изучен полиморфизм микросателлитных локусов 4a110, A8, a43 ядерной ДНК и локуса COI-COII мтДНК в популяции пчел центральной части республики Башкортостан (Табл. 2).
По результатам анализа частот аллелей микросателлитных локусов были получены генетические расстояния Nei (1978) (Табл. 3), на основе которых кластерным анализом методом ближайшего соседа была построена дендрограмма генетических отношений населений пчел изучаемых нами популяций. На дендрограмме наблюдалось подразделение на 2 крупные ветви. Пчелы центральной части республики Башкортостан группируются совместно с ранее определенной гибридной популяцией Иглинского района, что свидетельствует о гибридизации данной популяции.
По результатам анализа наблюдаемых частот аллелей микросателлитных локусов 4a110, A8, a43 ядерной ДНК были рассчитаны коэффициенты инбридинга Fis и Fit, коэффициент дифференциации Fst и гетерозиготность Ho, Hs и Ht, для изучаемых нами локальных популяций.
В популяции центральной части республики Башкортостан наблюдается аутбридинг Fis=-0,287 и Fit=-0,199. Кроме того в популяции наблюдается низкий уровень генетической подразделенности Fst=0,068 и избыток гетерозиготности Ho=0,634 < Hs=0,486 и Ht=0,504.На основе сравнительного анализа нуклеотидной последовательности фрагмента гена ND2 мтДНК подвидов A.m.сarnica, A.m.carpatica, A.m.caucasica, A.m.ligustica было обнаружено 11 сайтов замен нуклеотидов (Табл. 5).
На основе кластерного анализа методом ближайшего соседа фрагментов гена ND2 мтДНК подвидов пчел была построена дендрограмма, на которой карпатские пчелы, ранее не определенные однозначно группировались в отдельный кластер, отличный от подвидов A.m.сarnica, A.m.caucasica и A.m.ligustica (Рис. 2).
Таким образом, на основе анализа полиморфизма микросателлитных локусов 4a110, a8, a43 ядерной ДНК и межгенного локуса COI-COII мтДНК в популяции медоносной пчелы Кушнаренковского района было показано значительное влияние трутневого фона гибридного происхождения. Также была определена генетическая структура популяции медоносной пчелы Кушнаренковского района на основе анализа полиморфизма микросателлитных локусов 4a110, a8, a43 ядерной ДНК, которая характеризуется аутбридингом, низким уровнем генетической подразделенности и избытком гетерозиготности. На основе сравнительного анализа нуклеотидной последовательности фрагмента гена ND2 мтДНК показана генетическая обособленность популяции пчел Закарпатской области Украины.
We have studied the polymorphism of microsatellite loci 4a110, A8, a43 nuclear DNA loci and mtDNA COI-COII in the bee population of the central part of the republic of Bashkortostan (Tab. 2).
According to the analysis of allele frequencies of microsatellite loci were obtained genetic distances Nei (1978) (Table. 3) on which the cluster analysis method of the nearest neighbor was constructed dendrogram of genetic relationship bee populations we studied populations. In the dendrogram observed unit 2 large branches. Bees are a central part of the Republic of Bashkortostan are grouped together with the previously defined hybrid populations iglinsky district, indicating that the hybridization of a given population.
According to the analysis of the observed allele frequencies of microsatellite loci 4a110, A8, a43 nuclear DNA were calculated inbreeding coefficients Fis and Fit, Fst differentiation factor and heterozygosity Ho, Hs and Ht, we study local populations.
The population of the central part of the Republic of Bashkortostan is observed outbreeding Fis = -0,287 and Fit = -0,199. Also in the population have low levels of genetic subdivision Fst = 0,068 and the excess of heterozygosity Ho = 0,634 <Hs = 0,486 and Ht = 0,504.Na basis of a comparative analysis of the nucleotide sequence of a gene fragment ND2 mtDNA subspecies Amsarnica, Amcarpatica, Amcaucasica, Amligustica was There are 11 sites nucleotide substitutions (Table. 5).
On the basis of cluster analysis by the nearest neighbor ND2 gene fragments of mtDNA subspecies of bees dendrogram was built on which the Carpathian bees, previously defined clearly grouped in a separate cluster distinct from the subspecies Amsarnica, Amcaucasica and Amligustica (Fig. 2).
Thus, based on the analysis of polymorphism of microsatellite loci 4a110, a8, a43 nuclear DNA and the intergenic locus COI-COII mtDNA in honeybee populations Kushnarenkovsky area has been shown to significantly influence the background drone of hybrid origin. It was also determined the genetic structure of honey bee populations Kushnarenkovsky region based on the analysis of polymorphism of microsatellite loci 4a110, a8, a43 nuclear DNA, which is characterized by outbreeding, low levels of genetic subdivision and excess heterozygosity. On the basis of a comparative analysis of the nucleotide sequence of a gene fragment ND2 shown mtDNA genetic isolation of populations of bees of the Transcarpathian region of Ukraine.  
  097. Kolbina L., Nepevoda S., Nikolenko A., Ilyasov R., Vorobyeva S., Maslennikov I. The race analysis of bee-colonies from Sharkanskiy and Zavyalovskiy districts of the Udmurt Republic. XLVIII Naukowa konferencja pszczelarska. Materials of international conference. 2011. Pszczyna. 2011. P. 31-32.  

In our research the samples from 15 bee-colonies from Koryakino, 19 from Sharkan, 19 from Lyuk, 15 - Postol, and 5 from Makarovo were used. In this research we used morphometric and genetic (the polymorphism of intergenic locus COI-COII) methods (table 1).
The bee-colonies from Postol population descend from bees queens of southern races without admixture of aboriginal race (as show morphological studies, P<0.001) and the bee-colonies from Lyuk and Makarovi descend from populations of bees queen of the Apis mellifera mellifera and have no genes of southern races. But analysis of the exterior of the bee-colonies of these two populations suggests that a serious hybridization of colonies takes place on the drone line, since there are serious differences with the standard of the Apis mellifera mellifera (cubital index is less than 57% and almost 20% of bee- colonies have width of third tergite less than 4.8 mm). The Sharkan and Koryakino populations have no clear parentage of the maternal line, and in Sharkan population the few colonies have an abnormal structure of the intergenic locus COl-COII of mitochondrial DNA - PQ. All of these confirms the version of heterogeneous parentage of these bee- colonies. However, morphological characteristics of both these populations, especially Koryakino population, are close to the Apis mellifera mellifera and do not satisfy the standard only by cubital index (<60%) (that occurs not in all bee-colonies). As a result, none of the studied populations can be an attribute to the Apis mellifera mellifera race of bees.
  098. Хажеева Р.Р., Ильясов Р.А. Популяции темной лесной пчелы Apis mellifera mellifera L. Урала и Поволжья. Mатериалы докладов Международной научно-практической конференции "Современные проблемы биологии и экологии". Махачкала. 2011. C. 212-213.  

Медоносная пчела Apis mellifera L. в различных природно-климатических условиях изменялась соответственно условиям обитания. В результате длительного естественного отбора пчелы стали отличаться по ряду признаков. В разных биоценозах сформировались местные, географические расы пчел. На основе морфологических признаков выделяют 28 подвидов (Engel, 1999), медоносные пчелы вида Apis mellifera L. Наиболее широкое распространение в практической деятельности человека получили пчелы итальянской, среднерусской, серая горная кавказской, краинской, карпатской рас. Развитие сельского хозяйства и транспорта привел к распространению во всем мире медоносных пчел, что стало началом гибридизации подвидов. В России огромный естественный ареал охватывает подвид Apis mellifera mellifera L. (темная лесная пчела).
На территории республики Башкортостан многие тысячелетия существует подвид A.m.mellifera, обладающий хорошей адаптацией к резко континентальному климату горного Урала и способностью к активному, кратковременному медосбору в условиях короткого лета (Кожевников, 1929). Но массовый завоз южных пчел привел к массовой гибридизации и нарушению генетической системы популяции A.m.mellifera в республики Башкортостан (Газизов, 1987; Билаш и др., 1996; Гранкин, 1997).
Темная лесная пчела имеет ряд сохранившихся локальных популяций на Среднем Урале и в Поволжье. Исследования на основе морфометрических признаков и анализа полиморфизма межгенного локуса COI-COII митохондриальной ДНК показал состояние генофонда популяции A.m.mellifera (Николенко, Поскряков, 2002, Ильясов и др., 2006).
А.В. Петухов с соав. (1996) на основе исследования экстерьерных признаков пчел в Пермской области показали, что местные пчелы неоднородны по своему составу. На пасеках Уинского, Красновишерского, Нытвенского, Частинского, Кункурского районов параметры соответствовали параметрам среднерусской расы. На пасеках Чернушинского, Очерского, Куединского районов признаки свидетельствовали о гибридизации пчел. Гибридизированные пчелы в изученной части популяции составляли в среднем 25 %. На этих территориях для обогащения генофонда проводился обмен матками и пакетами пчел между областями с целью создания единого массива пчел прикамской популяции. Авторами были четко выделены генотипически сходные группы в двух районах: Красновишерском и Уинском.
Исследования А. В. Петухова с соавт., на основе морфометрических признаков и Р.А. Ильясова с соавт. (2006), на основе полиморфизма межгенного локуса COI-COII мт ДНК позволяли говорить о существовании на Среднем Урале и в Поволжье локальных популяций A.m.mellifera. Таким образом, были обнаружены локальные популяции A.m.mellifera: красновишерская, южно-прикамская, татышлинская и бурзянская. А принадлежность уинской популяции к A.m.mellifera не подтвердились.
Л.М. Колбиной, С.Н. Непейвода (2005) были изучены пасеки шести районов Удмуртской республики: Завьяловского, Якшур-Бодьинского, Камбарского, Вавожского, Шарканского и Воткинского. От каждой семьи отбиралось по 30 пчел. Всего было исследовано 188 семей. По результатам исследований только у 23 семей средние значения морфометрических признаков входили в рамки среднерусской породы, еще 23 семьи были отнесены к южным породам, остальные 142 семьи являются гибридными даже по средним значениям. По результатам исследований выявлено большое подвидовое разнообразие и высокий уровень гибридизации.
Р.А. Ильясов с соавт. (2007) отметили, что на территории Бурзянского, Бирского, Татышлинского районов существуют локальные популяции Apis mellifera mellifera. Пчёлы, собранные на пасеках этих районов Республики Башкортостан, характеризовались довольно высоким уровнем частоты встречаемости комбинаций PQQ мт ДНК. Для среднерусской пчелы A.m.mellifera характерны локусы PQ, PQQ, PQQQ (Cornuet, Garnery, 1991) по материнской линии. В Кушнаренковской, Благовещенской, Иглинской районах выборки популяции темной лесной пчелы находились в некоторой степени гибридизации. Р.А. Ильясов с соавт. (2010) собрали и проанализировали медоносные пчелы A.m.mellifera из заповедника Шульган-Таш Бурзянского района республики Башкортостан, из Башкирской опытной станции пчеловодства Иглинского района республики Башкортостан и из Юсьвенского района Коми-Пермяцкого округа Пермского края. Проведенный анализ трех удаленных друг от друга популяций показал, что сохранились локальные популяции медоносной пчелы подвида A. m. mellifera, которые способны к длительному существованию во времени (Ильясов с соавт., 2010).
213
Л. М. Колбина (2009) провела сравнение популяции пчел Западного Предуралья с гибридной популяцией Иглинского района республики Башкортостан на основе анализа ядерной и мт ДНК. Результат анализа показал обособленность Завьяловской популяции пчёл от Комбарской, Мало-Пургинской, Глазовской, Можгинской, Шарканской и Иглинской разделенные на две достоверно отличающиеся друг от друга группы, внутри которых не наблюдаются статистически значимой генетической дифференциации. На территории Западного Предуралья наблюдается генетически подразделенная популяция пчёл среднерусской расы, частично гибридизированная с подвидами из южных регионов.
А.Н. Талипов (2007) проводил исследования пчел районов Башкирского Зауралья: Учалинского,
Абзелиловского, Баймакского, Зианчуринского, Зилаирского, Белорецкого, Хайбуллинского и полученные данные сопоставил с пчелами из пасек Бурзянского района горно-лесной зоны Башкортостана. Изучение пчелы из пасек Бурзянского района горно-лесной зоны Башкортостана показало, что там находится основное генетическое ядро диких бортевых пчел. Морфологическая и генетическая дифференциация пчел Башкирского Зауралья по сравнению с бурзянской бортевой указывали на процессы гибридизации, представляющие угрозу чистоте ее генофонда.
Таким образом, на Урале и в Поволжье генетическая структура популяций A.m.mellifera изучена недостаточно. В связи с этим в дальнейшем планируем детальное изучение генетической структуры популяции темной лесной пчелы на Урале.
A honey bee Apis mellifera L. in different climatic conditions varied environmental conditions, respectively. As a result of a long natural selection bees began to differ on a number of grounds. In different biological communities formed local geographical races of bees. On the basis of morphological characters distinguish 28 subspecies (Engel, 1999), honeybees Apis mellifera L. species most widely used in practice people received the Italian bee, central Russia, gray mountain Caucasian Krajina, Carpathian races. The development of agriculture and transport has led to the worldwide dissemination of honeybees that was the beginning of hybridizing subspecies. Russia has huge natural range covers subspecies of Apis mellifera mellifera L. (dark forest bee).
On the territory of the Republic of Bashkortostan for many millennia there subspecies Ammellifera, has a good adaptation to the extreme continental climate of the Urals Mining and the ability to take an active, short-term honey flow in the short summer (Kozhevnikov, 1929). But the massive importation of bees led to the Southern hybridization and mass violation of the genetic system Ammellifera population in the Republic of Bashkortostan (Gazizov 1987; Bilash et al., 1996; Grankin, 1997).
The dark forest bee has a number of surviving local populations in the Middle Urals and the Volga region. Studies based on morphometric traits and polymorphism analysis of intergenic locus COI-COII mitochondrial DNA showed the state of the gene pool of the population Ammellifera (Nikolenko, Poskryakov, 2002, Ilyasov et al., 2006).
AV Petukhov with Soave. (1996) based on a study of exterior signs of bees in the Perm region showed that native bees are heterogeneous in composition. On apiaries Uinskogo, Krasnovishersky, Nytvensky, Chastinskogo, Kunkurskogo areas settings match the settings of Central race. On apiaries Chernushinsky, Ocher, Kuedinsky areas showed signs of hybridization bees. Hybridized bees in a part of the population studied averaged 25%. In these areas, to enrich the gene pool held an exchange queens and packages of bees between regions with the aim of creating a single array bee populations in Kama region. The authors clearly marked genotypically similar groups in two areas: Krasnovishersky and Uinskom.
Research AV Petukhov et al., Based on the morphometric characters and RA Ilyasov et al. (2006), based on the polymorphism of the intergenic locus COI-COII mt DNA suggests the existence of the Middle Urals and the Volga region of local populations Ammellifera. Thus, local populations were found Ammellifera: Krasnovishersk, South Prikamskaya, tatyshlinskaya and Burzyan. A membership to the population uinskoy Ammellifera not confirmed.
LM Kolbina, SN Nepeivoda (2005) were studied apiary six districts of the Udmurt Republic: Zavyalovsky, Yakshur-Bodyinsky, Kambarka, Vavozh, Sharkansky and Votkinsk. From each family were selected to 30 bees. There were studied 188 families. According to the research only 23 families mean values ​​of morphometric characters are within the scope of Central Russian breed, another 23 families were assigned to the southern species, the remaining 142 families are hybrid even mean values. According to the research identified a large variety of subspecies and a high level of hybridization.
RA Ilyasov et al. (2007) noted that in the territory Burzyansky, Birsk, Tatyshlinskogo areas there are local populations of Apis mellifera mellifera. Bees collected on apiaries those areas of the Republic of Bashkortostan, were characterized by a fairly high frequency of combinations PQQ mt DNA. For the Central Russian bees Ammellifera characterized loci PQ, PQQ, PQQQ (Cornuet, Garnery, 1991) through the maternal line. In Kushnarenkovsky, Annunciation, iglinsky district sampling dark forest bee populations are in some degree of hybridization. RA Ilyasov et al. (2010) collected and analyzed honeybees Ammellifera of reserve Shulgan-Tash Burzyansky district of the republic of Bashkortostan, Bashkir Research Station of beekeeping iglinsky district of the Republic of Bashkortostan and Yusvenskogo region of Komi-Perm district of the Perm region. The analysis of three widely separated populations showed that preserved local populations of the honey bee subspecies A. m. mellifera, which are capable of continued existence in time (Ilyasov et al., 2010).
213
LM Kolbina (2009) compared the bee population of the Western Urals hybrid population iglinsky district of Bashkortostan Republic on the basis of the analysis of the nuclear DNA and mtDNA. The results showed the isolation of populations of bees from Zavyalovsky Kombarskoy, Little Purginskoy, Glazov, Mozhginsky, Sharkan and Iglinsky divided into two significantly different from each other group, within which no statistically significant genetic differentiation. On the territory of the Western Urals observed genetically subdivided population of bees of Central race, partially hybridized with the subspecies of the southern regions.
AN Talipov (2007) conducted research on bees of the Bashkir Trans-Urals regions: Uchalinsky,
Abzelilovsky, Baimak, Zianchurinskogo, Zilair, Beloretsk, Haybullinskogo and findings contrasted with bees from apiaries Burzyansky area mountain-forest zone of Bashkortostan. The study bees from apiaries Burzyansky area mountain-forest zone of Bashkortostan showed that there is a fundamental genetic tree hollow core of wild bees. Morphological and genetic differentiation of bees of the Bashkir Trans-Urals compared with wild-hive Burzyan indicates the process of hybridization that threaten the purity of its gene pool.
Thus, in the Urals and the Volga region Ammellifera genetic structure of populations is not well understood. In this regard, we plan to further detailed study of the genetic structure of populations of the dark forest bees in the Urals.
  099. Ilyasov R.A., Kutuev I.A., Petukhov A.V., Poskryakov A.V., Nikolenko A.G. Phylogenetic relationships of dark european honeybees Apis mellifera mellifera L. from the Russian Ural and West European populations. Journal of Apicultural Science. 2011. V. 55. No. 1. P. 67-76.  

Phylogenetics relationships of dark european honeybees Apis mellifera mellifera L. from the Russian ural and west european populations A mitochondrial DNA region covering 5'-end of the gene of the second subunit NADH dehydrogenase (ND2), was PCR amplifi ed in Dark European Honeybees Apis mellifera mellifera from the Urals (Russia) region and in the presumed Apis mellifera macedonica from the Ukraine. Phylogenetic analysis of sequenced DNA samples with GenBank (http://www.ncbi.nlm.nih.gov) data showed the existence of four evolutionary branches where the Ural honeybees were grouped with European A. m. mellifera, and Ukrainian honeybees with European A. m. macedonica. These results suggest the genetic relationship of the Russian Urals and the European populations of A. m. mellifera. These data have allowed us to put forward the hypothesis that the subspecies A. m. mellifera, is a unique specimen of evolutionary branch M. Publication Name: Ilyasov R.A., Kutuev IA, Petukhov A.V., Poskryakov A.V., Nikolenko A.G. Phylogenetics relationships of dark european honeybees Apis mellifera mellifera L. from the Russian Ural and west european populations. Journal of Apicultural Science. 2011. V. 55 (1). P. 67-76.

  100. Колбина Л.М., Непейвода С.Н., Воробьева С.Л., Санникова Н.А., Масленников И.В. Ильясов Р.А., Николенко А.Г. Генетическая дифференциация популяций Apis mellifera L. в Удмуртской Республике. Аграрная наука Евро-северо-востока. 2011. № 6 (25). С. 46-50.

Генетическая дифференциация популяций Apis mellifera L. в Удмуртской Республике (Genetic differentiation of populations of Apis mellifera L. in the Udmurt Republic)
В данной работе приведены результаты исследований генетического потенциала пчел в Удмуртской Республике. В ходе сравнительного популяционно-генетического анализа пчелиных семей определено, что популяции пчел Удмуртии генетически неоднородны.
This paper presents the results of studies of the genetic potential of bees in the Udmurt Republic. During the comparative population-genetic analysis of bee colonies is determined that the bee population of Udmurtia genetically heterogeneous.
Publication Name: Kolbina L.M., Nepeivoda S.N., Vorobyov S.L., Sannikov N.A., Maslennikov I.V., Ilyasov R.A., Nikolenko A.G. Genetic differentiation of populations of Apis mellifera L. in the Udmurt Republic. Agricultural science Euro-north-east. 2011. V. 6 (25). P. 46-50.
  101. Непейвода С.Н., Колбина Л.М., Воробьева С.Л., Санникова Н.А., Масленников И.В. Ильясов Р.А., Николенко А.Г. Анализ генетической дифференциации популяций Apis mellifera в Удмуртии. Пчеловодство. 2011. № 10. С. 12-13.  

Анализ генетической дифференциации популяций Apis mellifera в Удмуртии (Analysis of genetic differentiation of populations of Apis mellifera in Udmurtia republic)
В данной работе приведены результаты исследований генетического потенциала пчел в Удмуртской Республике. В ходе сравнительного популяционно-генетического анализа пчелиных семей определено, что популяции пчел Удмуртии генетически неоднородны.
This paper presents the results of studies of the genetic potential of bees in the Udmurt Republic. During the comparative population-genetic analysis of bee colonies is determined that the bee population of Udmurtia genetically heterogeneous.
Publication Name: Nepeivoda S.N. Kolbina L.M., Vorobyova S.L. , Sannikov N.A., Maslennikov I.V., Ilyasov R.A., Nikolenko A.G. Analysis of genetic differentiation of populations of Apis mellifera in Udmurtia republic. Russian journal of beekeeping. 2011. V. 10. P. 12-13.
  102. Брандорф А.З., Ивойлова М.М., Ильясов Р.А., Поскряков А.В., Николенко А.Г. Популяционно-генетическая дифференциация медоносных пчел Кировской области. Пчеловодство. 2012. № 7. С. 14-16.  

Популяционно-генетическая дифференциация медоносных пчел Кировской области (Population genetic differentiation of honey bees of the Kirov region)
Показаны результаты анализа породной принадлежности семей медоносных пчел на территории Кировской области с использованием популяционно-генетического и фенотипического методов. Установлено, что, несмотря на гибридизацию местных пчел другими породами, выявляются ареалы локальных популяций аборигенной среднерусской породы.
The results of the analysis of breed of the families of honeybees in the Kirov region using population genetic and phenotypic methods. It was found that, despite the hybridization of native bees other breeds, identifies areas of local populations of native Central Russian breed.
Publication Name: Brandorf A.Z., Ivoilova M.M., Ilyasov R.A., Poskryakov A.V. Nikolenko A.G. Population genetic differentiation of honey bees of the Kirov region. Russian journal of beekeeping. 2012. V. 7. P. 14-16.
  103. Ильясов Р. А., Гайфуллина Л. Р., Салтыкова Е. С., Поскряков А. В., Николенко А. Г. Дефенсины в противоинфекционной защите медоносной пчелы. Журнал эволюционной биохимии и физиологии. 2012., т. 48, № 5. С. 425-432.  

Дефенсины в противоинфекционной защите медоносной пчелы (Antimicrobial protection of defensins in the honeybees)
Специфические условия жизни медоносной пчелы требуют наличия эффективных механизмов противоинфекционной защиты, одним из важнейших компонентов которой являются дефен-сины — семейство антимикробных пептидов. У медоносной пчелы дефенсины присутствуют в виде двух разных пептидов —дефенсина 1 и 2, обладающих сходством между собой лишь на 55.8 %. Дефенсин 1, синтезируемый в слюнных железах, выполняет важную роль в социальном иммунитете, тогда как дефенсин 2, синтезируемый клетками жирового тела и гемолимфы, является важным фактором в системе индивидуального иммунитета медоносной пчелы. Дефенсины индуцибельны, контролируются взаимодействием Toll и Imd сигнальных путей и обладают широким спектром антимикробного действия.
Specific conditions of life of the honeybee require effective mechanisms of anti-infectious protection, one of the most important components of which are dephenyl Sina - a family of antimicrobial peptides. In honeybee defensins are present as two different peptides -defensina 1 and 2 having a similarity between only 55.8%. Defensin 1, synthesized in the salivary glands, plays an important role in social immunity, whereas defensin 2, synthesized by cells of the fat body and hemolymph, is an important factor in the individual immunity of the honey bee. Defensins inducible, controlled interaction Toll and Imd signaling pathways and have a broad spectrum of antimicrobial action.
Publication Name: Ilyasov R.A., Gaifullina L.R., Saltykov E.S., Poskryakov A.V., Nikolenko A.G. Antimicrobial protection of defensins in the honeybees. Journal of Evolutionary Biochemistry and Physiology. 2012, v. 48 (5) . P. 425-432.
  104. Ilyasov R.A., Gaifullina L.R., Saltykova E.S., Poskryakov A.V., Nikolenko A.G. Review of the Expression of Antimicrobial Peptide Defensin in Honey Bees Apis Mellifera L. Journal of Apicultural Science. 2012. Vol.56 No.1. P.115-124.  

Review of the Expression of Antimicrobial Peptide Defensin in Honey Bees Apis Mellifera L. Honey bees defensin have a high level of polymorphism and exist as two peptides - defensin 1 and 2. Defensin 1 is synthesized in the salivary glands and is responsible for social immunity. Defensin 2 is synthesized by cells of the fat body and hemolymph is responsible for individual immunity. Defensins are inducible and controlled by the interaction of Toll and Imd signaling pathways and have a broad spectrum of antimicrobial action. The use of chitosan as an immunomodulator has been shown to lead to an increase in the expression levels of defensin and abaecin in the honey bee organism. Stimulation of the transcriptional activity of the defensin genes will allow for the control of a honey bee colony’s immunity level, and reduce the using of antibiotics and other chemicals. Publication Name: Ilyasov R.A., Gaifullina L.R., Saltykova E.S., Poskryakov A.V., Nikolenko A.G. Review of the Expression of Antimicrobial Peptide Defensin in Honey bees Apis mellifera L. Journal of Apicultural Science. 2012. Vol.56 No.1. P.115-124.

  105. Симанков М.К., Макаров В.Л., Симанков В.М., Ильясов Р.А., Поскряков А.В., Николенко А.Г. Морфогенетическая характеристика медоносной пчелы Пермского края. Материалы третьего международного форума пчеловодов «Медовый мир». Ярославль. 2012. С. 55-58.

Среднерусская пчела занимает широкий ареал обитания. В настоящее время по всему ареалу среднерусских пчёл преобладают гибриды разных рас пчёл. Пермский край является северной границей естественного обитания всего вида Apis mellifera L. Ранее установлено (Петухов, 1996; Ильясов и др., 2006), что аборигенная  популяция медоносной пчелы неоднородна – есть пасеки как с чистопородными, так и с гибридными пчелиными семьями.
Целью настоящего исследования являлось продолжение изучения структуры популяции медоносной пчелы Пермского края. Для этого определяли:
1.    морфометрические признаки рабочих пчёл по общепринятой методике (Билаш, Кривцов, 1991);
2.    кубитальный индекс крыла рабочих пчёл в программе CooRecorder;
3.    полиморфизм локуса COI-COII митохондриальной ДНК, что является генетическим маркером расовой принадлежности пчел (Николенко и др., 2002).
Для исследования расовой принадлежности, а также для определения и оценки степени гибридизации, были исследованы десять пасек из разных районов Пермского края (табл. 1).
Для анализа морфометрических признаков на каждой пасеке были исследованы до 10% пчелосемей. В сентябре отбирали по 25 особей от анализируемой семьи, помещали в картонные емкости и замораживали. Для исследования кубитального индекса и проведения генетического анализа с каждой пасеки отбирали по 100 пчёл и фиксировали их в 96% этаноле.
Материалы и методы
Техника препарирования частей тела пчелы
Обработка пчел, техника препарирования частей тела, измерение линейных признаков производилось в соответствии рекомендациями Г.Д. Билаша, Н.И. Кривцова (1991) и ВНИИ Пчеловодства. Отпрепарированные хитиновые части тела пчёл приклеивали с помощью канцелярского клеящего карандаша на бумагу и ламинировали. Часть измерений производили с помощью окуляр-микрометра на бинокуляре МБС-9. Крылья сканировали и в программе CooRecorder по кубитальному индексу определяли расовую принадлежность исследуемых пчёл. Стандартными значениями кубитального индекса среднерусских пчёл считается 60-65%, или 1,7 по европейским стандартам. Для пчёл южных рас характерен индекс меньше 60%, или больше 1,7. Информативную картину даёт графическое представление, в виде вариационных кривых, значений кубитального индекса.
В комплексе морфометрических исследований использовали длину хоботка, длину и ширину правого переднего крыла, его кубитальный индекс, длину и ширину четвертого тергита.
Всего исследовано 1600 особей пчел с 98 пчелиных семей с 10 пасек, изготовлено 2800 препаратов, произведено 8400 измерений с помощью окуляр-микрометра на бинокуляре МБС-9.
Методика проведения генетического анализа
Исследования по генетическому анализу проводилась совместно с Р.А. Ильясовым, А.В. Поскряковым и А.Г. Николенко из Института биохимии и генетики Уфимского научного центра РАН. Основу генетического анализа составил установленный ранее полиморфизм межгенного локуса COI-COII у представителей разных подвидов медоносной пчелы Apis mellifera. Установлено, что протяженный АТ-богатый межгенный участок мтДНК., локализованный между генами COI и COII и не кодирующий аминокислотной последовательности, может быть использован в качестве маркера для различения подвидов Apis mellifera mellifera (пчела среднерусской расы) и A.m.caucasica (серая горная кавказская пчела) благодаря вариабельности длины, обусловленной различным соотношением элементов Р и Q, где межгенный участок у представителей ветви М (A.m.mellifera), аборигенных для Пермского края, имеет комбинацию PQQ, тогда как у представителей ветви С (A.m.caucasica, A.m.camica, A.m.ligustica), гибридизация с которыми наблюдается на территории Пермского края, имеется единственный элемент Q. Таким образом, межгенный локус COI-COII мтДНК у представителей эволюционной ветви С и их гибридов по материнской линии на 268 п.н. короче межгенного локуса COI-COII мтДНК у представителей ветви М, и эти локусы легко разделяются при электрофорезе. Размер продукта ПЦР межгенного локуса COI-COII мтДНК, включающий и ген тРНКLeu у представителей A.m.mellifera, равен примерно 600 п.н., а у представителей эволюционной ветви С и их гибридов по материнской линии - 350 п н. Этот маркер был использован нами для поиска популяций A.m.mellifera.
Для анализа мтДНК с каждой пасеки брали по 100 рабочих особей, которых фиксировали в 96% этаноле и хранили в морозильной камере. Тотальную ДНК выделяли из летательных мышц пчел смесью гуанидинтиоционат-фенол-хлороформ по методу P. Chomezynski и N. Sacchi (1987). В качестве генетического маркера использовали межгенный локус COI-COII мтДНК, полиморфизм которого для представителей разных подвидов Apis mellifera был установлен ранее. Полимеразную цепную реакцию (ПЦР) проводили в термоциклере «Циклотерм» при оптимальном температурном режиме. Выделенную ДНК проверяли на качество в 1,5 % агарозном геле. Продукты ПЦР электрофоретически фракционировали в полиакриламидном геле, после чего окрашивали бромистым этидием и фотографировали на трансиллюминаторе.
Результаты и обсуждения
Морфометрические признаки пчёл
Морфометрическому анализу подвергали пчёл с разведенческих пасек края – хоз-во «Покровское» Осинского района, «Парасоль» Пермского района, а также пчёл биостанции ПГПУ «В.-Кважва» Добрянского района. В результате подробного морфометрического анализа были отобраны пчелиные семьи в «племенное ядро» пасек. Средние значения морфометрических признаков по пасекам приведены в таблице 2.
В результате установлено, что исследуемые пчёлы по всем признакам, кроме кубитального индекса соответствуют среднерусским пчёлам.
Кубитальный индекс крыла медоносной пчелы
Средние значения кубитального индекса занесены в сводную таблицу 3, при этом пасеки распределены в две группы – чистопородных (куб. инд.≤ 1,7) и метизированных (куб. инд. > 1,7).
Построенные вариационные кривые значений кубитального индекса дают наглядную информативную картину реального расположения признака (Рис. 1-10).
Дополнительный пик (или «горб») в интервалах не свойственных «чистым» расам – признак отдалённой гибридизации не смотря на то, что среднее значение кубитального индекса соответствует стандарту среднерусской расы ≤ 1,7 (Рис. 1). Иногда это единственный признак гибридизации, поскольку средняя величина кубитального индекса и других мофометрических признаков может соответствовать допустимым для А.m.mellifera значениям.
На отдельных пасеках в распределении значений пчёл в интервале 1,7-2,1 наблюдается избыточное количество пчёл в сравнении с нормальным, что так же свидетельствует о гибридизации с пчёлами южных рас.
Пик, на который приходится максимум встречаемости пчёл группы «метезированных» пасек, в интервале 1,7-1,9 – можно интерпретировать как проявление собственно гибридных пчёл (Рис. 7-10).
Таким образом, построенные вариационные кривые наглядно свидетельствуют о некоторой степени гибридизации пчёл исследованных пасек. Возможно это является особенностью экотипа среднерусских пчел Пермского края.
Молекулярно-генетический анализ пчёл
Кроме морфометрического был проведён молекулярно-генетический анализ пчёл пяти пасек края. Результаты первичного морфометрического анализа и частоты вариантов полиморфного локуса COI — C0 II мтДНК вместе с породными стандартами для среднерусской и серой горной кавказской пчёл приведены в таблице 4.
Пчелы, собранные с пасек края, характеризовались довольно высоким уровнем частоты встречаемости комбинаций PQQ мтДНК. Для среднерусской пчелы A.m.mellifera характерны локусы PQ, PQQ, PQQQ (Cornuet and Garnery, 1991) по материнской линии. По подсчетам частот встречаемости аллелей у всех исследованных пчёл доля аллеля PQQ выше 0,9.
 Значение коэффициента дифференциации Fst между пятью локальными популяциями А.m.mellifera при анализе микросателлитньх локусов 4а110 и ар243 ядерной ДНК изменялось в пределах от 0,028 до 0,123 (Табл. 5). Между большинством локальных популяций значение Fst близко к нулю и свидетельствует об отсутствии значительной генетической дифференциации. Отдельное внимание следует обратить на добрянскую локальную популяцию (В.-Кважва), где коэффициент Fst между ней и другими популяциями колеблется между 0,388 и 0,625 что намного больше, чем между остальными локальными популяциями. Это может свидетельствовать о значительных генетических различиях по отцовской линии.
Таким образом, проведенные исследования показали, что ни один из использованных методов не стоит абсолютизировать. Поскольку аборигенными пчелами для всего Поволжья, в том числе и Пермского края были среднерусские пчелы, то есть пчелы подвида Apis mellifera mellifera L, а завезенные семьи южных подвидов составляли небольшой процент от общего количества разводимых пчел, это привело к тому, что большая часть местных пчел имеет гибридизацию по отцовской линии. Большая вариабельность морфологических признаков, появившаяся в результате гибридизации привела к тому, что часть гибридных пчел может также по экстерьеру соответствовать A.m.mellifera. Поэтому достоверные результаты могут быть получены только при использовании как морфологических, так и молекулярно-генетических методов исследования, охватывающих не только митохондриальный, но и ядерный геномы.
Полученные нами результаты сравнительных пуляционно-генетических исследований прикамских пчел показали, что сочетание относительно высоких долей морфотипа характерного для A.m.mellifera и частот PQ, PQQ, PQQQ может свидетельствовать о том, что исследованные пчёлы имеют происхождение от среднерусских пчел. Некоторые отклонения от стандарта среднерусских пчел могут объясняться как незначительной гибридизацией, так и особенностями экотипа среднерусских пчел Пермского края.
Выводы
1.     Результаты морфометрического анализа показали, что популяция пчёл Пермского края соответствуют стандарту среднерусской расы.
2.     Вариационные кривые значений кубитального индекса показывают как гибридное, так и чистопородное происхождение пчел. Отклонение индекса от общепризнанного стандарта Apis mellifera mellifera возможно является особенностью экотипа среднерусских пчел Пермского края.
3.    Результаты молекулярно-генетического анализа по локусу COI-COII мтДНК и двум микросателлитным локусам ap243 и 4a110 свидетельствуют об отсутствии значительной генетической дифференциации популяции пчёл Пермского края и единстве происхождения популяции по материнской линии от пчел среднерусской расы, аборигенной для Северной Евразии.
Central Russian bee takes a habitat. At present the entire range of the Central Russian bees dominated hybrids of different races of bees. Perm region is the northern boundary of the natural habitat of the species Apis mellifera L. previously established (Petukhov, 1996; Ilyasov et al., 2006) that the aboriginal populations of the honey bee is not uniform - there apiary both purebred and hybrid bee colonies.
The purpose of this study was to study the structure of the continuation of the honey bee population of the Perm region. To do this, define:
1. morphometric signs of working bees on the conventional method (Bilash, Krivtsov, 1991);
2. cubital index wing working bees in the program CooRecorder;
3. polymorphism locus COI-COII mitochondrial DNA, which is a genetic marker race of bees (Nikolenko et al., 2002).
To study the race, as well as to identify and assess the degree of hybridization were investigated ten apiaries from different areas of the Perm Territory (Table. 1).
For the analysis of morphometric characters in each apiary were examined up to 10% of bee colonies. In September 25 individuals were selected from families analyzed were placed in cardboard containers and frozen. To investigate the cubital index and a genetic analysis were taken from each apiary 100 bees and fixed in 96% ethanol.

Materials and methods
Technique of preparation of the body bees
Processing of bees, equipment preparation of the body, the measurement of linear features was carried out in accordance with the recommendations GD Bilash, NI Krivtsov (1991) and the Institute of Beekeeping. The prepared chitin body bees stuck using paper glue stick on paper and laminated. Some measurements were made using ocular micrometer on a binocular microscope MBS-9. The wings were scanned and the program CooRecorder cubital index was measured on race studied bees. The standard values ​​of cubital index Central Russian bees considered 60-65%, or 1.7 according to European standards. For bees southern races characteristic index is less than 60%, or greater than 1.7. Informative picture gives a graphical representation of variation curves, the values ​​of cubital index.
The complex morphometric studies used long proboscis, length and width of the right front wing, his cubital index, length and width of the fourth tergite.
Total studied 1600 individuals with 98 bee bee colonies from 10 apiaries, made preparations in 2800, produced 8,400 measurements using ocular micrometer on a binocular microscope MBS-9.
Methods of genetic analysis
Studies on the genetic analysis was conducted jointly with RA Ilyasov, AV Poskryakovym and AG Nikolenko from the Institute of Biochemistry and Genetics, Ufa Scientific Center, Russian Academy of Sciences. The basis of genetic analysis was installed earlier polymorphism intergenic locus COI-COII representatives of different subspecies of the honeybee Apis mellifera. It was found that the extended AT-rich intergenic site mtDNA. Localized between genes and COI COII and encoding the amino acid sequence can be used as a marker to distinguish between subspecies Apis mellifera mellifera (honeybee of Central race) and Amcaucasica (gray mountain Caucasian bee) due to variability in the length due to different ratios of elements P and Q, where the representatives of intergenic site branches of M (Ammellifera), native to the Perm region, has a combination of PQQ, whereas representatives of branches with (Amcaucasica, Amcamica, Amligustica), Hybridization which is observed in the Perm region, there is a unique element of Q. Thus, intergenic locus COI-COII mtDNA from representatives of evolutionary branches with their hybrids and maternal 268 bp short intergenic locus COI-COII mtDNA from representatives of branches of M and these loci are easily separated by electrophoresis. The size of the PCR product intergenic locus COI-COII mtDNA gene and comprising the representatives tRNKLeu Ammellifera, is about 600 bp, and the representatives of the evolutionary branches with their hybrids and the maternal line - 350 n n. This marker was used to search for our populations Ammellifera.
For the analysis of mtDNA from each apiary took 100 working individuals, which were fixed in 96% ethanol and stored in a freezer. Total DNA was isolated from muscle flying bee mixture guanidintiotsionat-phenol-chloroform method P. Chomezynski and N. Sacchi (1987). As the genetic marker used intergenic locus COI-COII mtDNA polymorphisms for which representatives of different subspecies Apis mellifera has been installed earlier. Polymerase chain reaction (PCR) was performed in a thermal cycler "Tsikloterm" at the optimum temperatures. The isolated DNA was checked on quality in a 1.5% agarose gel. PCR products were fractionated electrophoretically in a polyacrylamide gel, then stained with ethidium bromide and photographed on a transilluminator.
Results and Discussion
Morphometric characters bees
Morphometric analysis were bees from apiaries razvedencheskih region - host of "Pokrovskoye" Osa region, "Parasol" the Perm region, as well as bees biostation PGPU "V.-Kvazhva" Dobriansky area. As a result of detailed morphometric analysis were selected bee colonies in the "tribal core" apiaries. The mean values ​​of morphometric characters of apiaries are shown in Table 2.
As a result, it found that the bees studied by all indications, except for cubital index correspond Srednerussky bees.
Cubital index wing honeybee
The average values ​​of cubital index are included in the summary table 3, with the apiary divided into two groups - purebred (cu. Ind.≤ 1.7) and metizirovannyh (cu. Ind.> 1.7).
Built variation curves cubital index values ​​give a clear picture of the actual location of the informative sign (Fig. 1-10).
Additional peak (or "hump") at intervals not peculiar to the "pure" races - a sign of distant hybridization despite the fact that the average value of the cubital index complies with the race of Central ≤ 1,7 (Fig. 1). Sometimes it's the only sign of hybridization, since the average value of cubital index and other signs can match mofometricheskih valid for A.m.mellifera values.
At some apiaries in the distribution of values ​​in the range of 1.7-2.1 bees observed an excess amount of bees than normal, which also suggests hybridization with bees southern races.
Peak, which accounts for a maximum occurrence of bees group "metezirovannyh" apiaries in the range of 1.7-1.9 - can be interpreted as a manifestation of the actual hybrid bees (Fig. 7-10).
Thus, the built variation curves clearly demonstrate a certain degree of hybridization bees apiaries studied. Perhaps this is a feature of the Central Russian bee ecotype Perm.
Molecular genetic analysis of bees
Additionally morphometric was conducted molecular genetic analysis of five bees apiaries edge. The results of the primary morphometric analysis and frequency variants polymorphic locus COI - C0 II mtDNA with the breed standards for central Russia and gray mountain Caucasian bees are shown in Table 4.
Bees collected from apiaries the region, characterized by a fairly high frequency of combinations PQQ mtDNA. For the Central Russian bees Ammellifera characterized loci PQ, PQQ, PQQQ (Cornuet and Garnery, 1991) through the maternal line. According to estimates of the frequency of alleles in all studied the bees share allele PQQ above 0.9.
 Fst value of the coefficient of differentiation between the five local populations when analyzing A.m.mellifera mikrosatellitnh loci 4a110 ar243 and nuclear DNA varied from 0.028 to 0.123 (Table. 5). In the majority of the local populations Fst value close to zero indicates the absence of significant genetic differentiation. Special attention should be paid to the local population Dobriansky (B.-Kvazhva), where the coefficient Fst between it and other populations varies between 0.388 and 0.625 is much higher than among the rest of the local populations. This may indicate a significant genetic differences on the paternal side.
Thus, studies have shown that none of the methods used is not absolute. Since the native bees for the whole Volga region, including Perm Krai were Central Russian bees, ie bee subspecies Apis mellifera mellifera L, and the family of the southern subspecies imported accounted for a small percentage of the total farmed bees, this has led to the fact that most of the local bees hybridization is paternal. Large variability of morphological characters that appeared as a result of hybridization has led to the fact that part of the hybrid bees can also match the exterior Ammellifera. Therefore, accurate results can be obtained only by using both morphological and molecular genetic research methods, covering not only the mitochondrial, and nuclear genomes.
Our results of comparative population genetic studies Kama bees showed that the combination of the relatively high proportion of morphotype Ammellifera characteristic frequencies and PQ, PQQ, PQQQ may indicate that the bees have studied the origin of the Central Russian bees. Some deviations from the standard of the Central Russian bees can be explained as a minor hybridization and features of the Central Russian bee ecotype Perm.
Findings
1. The results of morphometric analysis showed that the population of bees Perm Territory to meet the standard of Central race.
2. The variation curve cubital index values ​​show how hybrid and purebred origin of bees. The deviation of the index from the generally accepted standard of Apis mellifera mellifera is a possible feature of the Central Russian bee ecotype Perm.
3. The results of the molecular genetic analysis of the locus of mtDNA COI-COII and two microsatellite loci ap243 4a110 and showed no significant genetic differentiation of populations of bees Perm region and the unity of the origin of the population through the maternal line of the Central Russian bee race, native to northern Eurasia.
  106. Ильясов Р.А., Поскряков А.В, Николенко А.Г., Брандорф А.З., Ивойлова М.М. Генетический и фенотипический анализ генофонда популяции Apis mellifera L. в Кировской области. Биомика. 2012. Т.3. № 1. С. 47-49.

Интродукции медоносных пчёл из отдаленных регионов началась более ста лет назад, с переходом от колодного к рамочному содержанию пчелиных семей. Согласно некоторых исследований, на территории Кировской области количество пчелиных семей среднерусской расы сохранилось не более 8% (ссылка). Данная ситуация является результатом массовой пропаганды и интродукции на территорию области пчелиных маток и пакетов карпатской (А. т. carpatica), серой горной кавказской (A. m.caucasica Gorb.), а в некоторые годы краинской (А. т. carnica), итальянской (А. т. ligustica Spin.) расы и даже дальневосточных пчёл.
По результатам расчёта коэффициента дифференциации между популяциями, кроме Кильмезской, отмечены значения близкие к нулю, что свидетельствует о низком уровне генетической дифференциации популяций (Fst=-0,154-0,057). Только в Кильмезской локальной популяции данный показатель составил Fst-0,202, при отрицательном коэффициенте инбридинга субпопуляций (Fit=-0,149), что является показателем аутбридинга, и может свидетельствовать об подержании биоразнообразия на высоком уровне, в связи с чем, данную популяцию можно рассматривать как источник поддержания генетического разнообразия медоносных пчёл А. т. mellifera.
Introduction of honey bees from remote regions began more than a hundred years ago, with the transition from Kolodny to the framework content of bee colonies. According to some studies, in the territory of the Kirov region number of bee colonies of Central race survived no more than 8% (link). This situation is the result of mass propaganda and introduction to the region of queen bees and packages Carpathian (A. m. Carpatica), gray mountain Caucasian (A. m.caucasica Gorb.), And in some years Krajina (A. m. Carnica), Italian (A. m. ligustica Spin.) Far Eastern races and even bees.
As a result of the calculation coefficient  of differentiation between populations, except Kilmezskoy, marked values ​​close to zero, which indicates a low level of genetic differentiation of populations (Fst = -0,154-0,057). Only Kilmezskoy local population the figure was Fst-0,202, with a negative coefficient of inbreeding subpopulations (Fit = -0,149), which is an indicator of outbreeding, and may be indicative of biodiversity used at a high level, and therefore, this population can be viewed as a source of maintain the genetic diversity of honey bees A. m. mellifera.
  107. Ильясов Р.А., Макаров В.Л., Поскряков А.В., Николенко А.Г. Популяционная характеристика среднеуральской медоносной пчелы. Материалы всероссийской молодежной конференции «Актуальные проблемы генетики и молекулярной биологии». Уфа. 2012. С. 155-158.  

ПОПУЛЯЦИОННАЯ ХАРАКТЕРИСТИКА СРЕДНЕУРАЛЬСКОЙ МЕДОНОСНОЙ ПЧЕЛЫ
Ключевые есть: Среднерусская пчела, ДНК-маркирование,
митохондриальная ДНК, марфометрия, популяция
Среднерусская пчела занимает широкий ареал обитания. В настоящее время по всему ареалу среднерусских пчёл преобладают гибриды разных рас пчёл. Пермский край является северной границей естественного обитания всего вида Apis mellifera L. Ранее установлено (Петухов, 1996; Ильясов и др., 2006), что аборигенная популяция медоносной пчелы неоднородна - есть пасеки как с чистопородными, так и с гибридными пчелиными семьями.
Целью настоящего исследования являлось продолжение изучения структуры популяции медоносной пчелы Пермского края. Для этого определяли:
1. морфометрические признаки рабочих пчёл по общепринятой методике (Билаш, Кривцов, 1991);
2. кубитальный индекс крыла рабочих пчёл в программе CooRecorder;
3. полиморфизм локуса С01-С0П митохондриальной ДНК, что является генетическим маркером расовой принадлежности пчел (Николенко и др., 2002).
Для исследования расовой принадлежности, а также для определения и оценки степени гибридизации, были исследованы десять пасек из разных районов Пермского края (Табл. 1).
Препарированные хитиновые части тела пчёл приклеивали с помощью канцелярского клеящего карандаша на бумагу и ламинировали. Часть измерений производили с помощью окуляр-микрометра на бинокуляре МБС-9. Крылья сканировали и в программе CooRecorder по кубитальному индексу определяли расовую принадлежность исследуемых пчёл. Стандартными значениями кубитального индекса среднерусских пчёл считается 60-65%, или меньше 1,7 по европейским стандартам. Для пчёл южных рас характерен индекс меньше 60%, или больше или равно 1,7.
Полученные значения морфометрических признаков по разведенческим пасекам приведены в таблице 2. В результате установлено, что исследованные пчёлы по всем признакам, кроме кубитального индекса, соответствуют среднерусским пчёлам A.m.mellifera.
занесены в сводную таблицу 3, при этом пасеки распределены в две группы - чистопородных (куб. инд.< 1,7) и гибридных (куб. инд.> 1,7).
Результаты морфометрического анализа и частоты вариантов полиморфного локуса COI - СОИ мтДНК совместно с породными стандартами для среднерусской и серой горной кавказской пчёл приведены в таблице 4.
Для среднерусской пчелы A.m.mellifera характерны варианты PQ, PQQ, PQQQ межгенного локуса COI-COII мтДНК по материнской линии. Пчелы, собранные с пасек Пермского края, характеризовались довольно высоким уровнем частоты встречаемости комбинаций PQQ мтДНК. По подсчетам частот встречаемости аллелей у всех исследованных пчёл доля варианта PQQ выше
0,9, что является показателем их принадлежности по происхождению к среднерусским пчелам в 90 % случаях.
Выводы
1. Результаты морфометрического анализа показали, что исследованные пчёлы соответствуют стандарту среднерусской расы. Особенностью является низкий кубитальный индекс.
2. Результаты молекулярно-генетического анализа по локусу COI-COII мтДНК свидетельствуют об отсутствии значительной генетической дифференциации пчёл Пермского края и единстве происхождения популяции по материнской линии от пчел среднерусской расы, аборигенной для Северной Евразии.
Population characteristics Sredneuralskaya Honeybees
The key is: Central Russian bee, DNA labeling,
Mitochondrial DNA marfometriya, population
Central Russian bee takes a habitat. At present the entire range of the Central Russian bees dominated hybrids of different races of bees. Perm region is the northern boundary of the natural habitat of the species Apis mellifera L. previously established (Petukhov, 1996; Ilyasov et al., 2006) that the aboriginal populations of the honey bee is not uniform - there apiary both purebred and hybrid bee colonies.
The purpose of this study was to study the structure of the continuation of the honey bee population of the Perm region. To do this, define:
1. morphometric signs of working bees on the conventional method (Bilash, Krivtsov, 1991);
2. cubital index wing working bees in the program CooRecorder;
3. polymorphism loci C01-S0P mitochondrial DNA, which is a genetic marker race of bees (Nikolenko et al., 2002).
To study the race, as well as to identify and assess the degree of hybridization were investigated ten apiaries from different areas of the Perm Territory (Table. 1).
Dissected chitin body bees stuck using paper glue stick on paper and laminated. Some measurements were made using ocular micrometer on a binocular microscope MBS-9. The wings were scanned and the program CooRecorder cubital index was measured on race studied bees. The standard values ​​of cubital index Central Russian bees considered 60-65%, or less than 1.7 according to European standards. For southern bees races characteristic index less than 60%, or greater than or equal to 1.7.
The values ​​obtained for morphometric characters razvedencheskim apiaries are shown in Table 2. As a result, found that the bees studied by all indications, except for cubital index corresponding Srednerussky bees Ammellifera.
listed in the summary table 3, with the apiary divided into two groups - purebred (cu. Ind. <1.7) and hybrid (cu. Ind.> 1.7).
The results of morphometric analysis and frequency variants polymorphic locus COI - SDI mtDNA together with standards for the breed of Central and gray mountain Caucasian bees are shown in Table 4.
For the Central Russian bees Ammellifera characterized options PQ, PQQ, PQQQ intergenic locus COI-COII maternal mtDNA. Bees collected from apiaries in the Perm region, characterized by a fairly high frequency of combinations PQQ mtDNA. According to estimates of the frequency of alleles in all studied the bees share options above PQQ
0.9, which is an indication of their belonging by birth to the Srednerussky bees in 90% of cases.
Findings
1. The results of morphometric analysis showed that the studied bees meet the standard of Central race. A special feature is the low cubital index.
2. The results of the molecular genetic analysis of locus COI-COII mtDNA showed no significant genetic differentiation bees Perm region and the un